SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37677265|ref|NP_937661.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37677265|ref|NP_937661.1|
Domain Number 1 Region: 5-152
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 1.83e-32
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37677265|ref|NP_937661.1|
Sequence length 158
Comment PTS system transporter subunit IIA [Vibrio vulnificus YJ016]
Sequence
MGLKQSLIENNSIKLQAQASNWRDAIKIGTDMLIASGAIEPCYHDAIISSVEELGPYICI
APNLALPHARPENGVNRTAFALVTLETPIYFEGEDEPVDVLITLAGSSSDEHMEGLMEVT
QVLDDEESDTGVDLDKLRRCRSLSDVFNVIDDALAMTA
Download sequence
Identical sequences A0A0H0XXV5 A0A1W6MCG9 Q7MBY2
196600.VVA1605 216895.VV2_1081 WP_011081981.1.16238 WP_011081981.1.17874 WP_011081981.1.21633 WP_011081981.1.22778 WP_011081981.1.25536 WP_011081981.1.33883 WP_011081981.1.34622 WP_011081981.1.54486 WP_011081981.1.55006 WP_011081981.1.58885 WP_011081981.1.66581 WP_011081981.1.67868 WP_011081981.1.73066 WP_011081981.1.79678 WP_011081981.1.81460 WP_011081981.1.8379 WP_011081981.1.90288 WP_011081981.1.93668 WP_011081981.1.9921 WP_011081981.1.99976 gi|27367471|ref|NP_762998.1| gi|320159320|ref|YP_004191698.1| gi|37677265|ref|NP_937661.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]