SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678188|ref|NP_932797.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678188|ref|NP_932797.1|
Domain Number 1 Region: 4-114
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-31
Family RNase P protein 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37678188|ref|NP_932797.1|
Sequence length 118
Comment ribonuclease P [Vibrio vulnificus YJ016]
Sequence
MNTYAFNRELRLLTPEHYQNVFQQAHRAGSPHFTIIARNNNLSHPRLGLAVPKKQIKTAV
GRNRFKRLARESFRNTQHQLPNKDFVVIAKKSAQDLSNEELFKLFDKLWHRLSRPSRG
Download sequence
Identical sequences A0A2H9X611 Q7MQK4 Q8DDI3
196600.VV0004 216895.VV1_1005 gi|37678188|ref|NP_932797.1| WP_011079040.1.100126 WP_011079040.1.13374 WP_011079040.1.16238 WP_011079040.1.17874 WP_011079040.1.21633 WP_011079040.1.22486 WP_011079040.1.22778 WP_011079040.1.24453 WP_011079040.1.25536 WP_011079040.1.28215 WP_011079040.1.28571 WP_011079040.1.30871 WP_011079040.1.31968 WP_011079040.1.33883 WP_011079040.1.34622 WP_011079040.1.39407 WP_011079040.1.39524 WP_011079040.1.43691 WP_011079040.1.47396 WP_011079040.1.49981 WP_011079040.1.512 WP_011079040.1.53345 WP_011079040.1.53782 WP_011079040.1.54486 WP_011079040.1.54603 WP_011079040.1.54858 WP_011079040.1.55006 WP_011079040.1.553 WP_011079040.1.58875 WP_011079040.1.58885 WP_011079040.1.59022 WP_011079040.1.59048 WP_011079040.1.59451 WP_011079040.1.60167 WP_011079040.1.60868 WP_011079040.1.61535 WP_011079040.1.63462 WP_011079040.1.63825 WP_011079040.1.65015 WP_011079040.1.66219 WP_011079040.1.66581 WP_011079040.1.67868 WP_011079040.1.73066 WP_011079040.1.73173 WP_011079040.1.78369 WP_011079040.1.78668 WP_011079040.1.79678 WP_011079040.1.81060 WP_011079040.1.81460 WP_011079040.1.81555 WP_011079040.1.82587 WP_011079040.1.8292 WP_011079040.1.8379 WP_011079040.1.84562 WP_011079040.1.86005 WP_011079040.1.86748 WP_011079040.1.89979 WP_011079040.1.90288 WP_011079040.1.93668 WP_011079040.1.94371 WP_011079040.1.95941 WP_011079040.1.96968 WP_011079040.1.9921 WP_011079040.1.99976 gi|27364439|ref|NP_759967.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]