SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678198|ref|NP_932807.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678198|ref|NP_932807.1|
Domain Number 1 Region: 395-561,731-796
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 7.32e-88
Family Type II DNA topoisomerase 0.00053
Further Details:      
 
Domain Number 2 Region: 4-213
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.8e-75
Family DNA gyrase/MutL, N-terminal domain 0.0000000525
Further Details:      
 
Domain Number 3 Region: 221-393
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.93e-59
Family DNA gyrase/MutL, second domain 0.000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37678198|ref|NP_932807.1|
Sequence length 805
Comment DNA gyrase subunit B [Vibrio vulnificus YJ016]
Sequence
MSNNYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNSIDEALAGHCKDIV
VTIHEDNSVSVSDDGRGIPTEMHPEENVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGV
SVVNALSEKVLLTIHRGGHTHSQTYRHGVPDAPLAIIGDTEKTGTTVRFWPSAETFTNIE
FHYDILAKRLRELSFLNSGVSIKLFDEREEDKKDHFMYEGGIQAFVTHLNRNKTPIHEKV
FHFNAEREDGIAVEVAMQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAALTRTLNSYMDK
EGYSKKAKTATSGDDAREGLTAVVSVKVPDPKFSSQTKDKLVSSEVKSAVESFMADKLND
FLAEHPSEAKTVCSKIIDAARAREAARKAREMTRRKGALDLAGLPGKLADCQEKDPALSE
LYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARFDKMLSSQEVATLITALGCGIG
RDEYNPDKLRYHNIIIMTDADVDGSHIRTLLLTFFYRQMPELIERGYVYIAQPPLYKVKK
GKQEQYIKDEDAMNQYQISLALDNAALHVNPDAPALAGEALEKLVQQYNAAIKLVDRMSR
RYPRALIHELIYVPRLSETQFADQAAMAAWTEQLVTQLNAKEVGASQYSFEIEHDAERGL
FSPKIVVRTHGVMHEYPLSVDLINSKEYQKLAELADALDGLIEEGAYIQRGERTQPVNSF
ASALEWLIKESRRGLSLQRYKGLGEMNPDQLWETTMDPETRRMMRVTIEDAVGADELFTT
LMGDQVEPRRNFIEENALKVANLDV
Download sequence
Identical sequences A0A0H0XS14 A0A1L9KP83 A0A1W6LZX1 Q7MQJ4
196600.VV0014 216895.VV1_0996 WP_011079032.1.16238 WP_011079032.1.17874 WP_011079032.1.25536 WP_011079032.1.34622 WP_011079032.1.53345 WP_011079032.1.58885 WP_011079032.1.73066 WP_011079032.1.79678 WP_011079032.1.81460 WP_011079032.1.8379 WP_011079032.1.93668 WP_011079032.1.94371 WP_011079032.1.9921 gi|37678198|ref|NP_932807.1| gi|27364430|ref|NP_759958.1| gi|320157813|ref|YP_004190192.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]