SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678213|ref|NP_932822.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678213|ref|NP_932822.1|
Domain Number 1 Region: 2-304
Classification Level Classification E-value
Superfamily ClpP/crotonase 8.18e-66
Family Crotonase-like 0.000000174
Further Details:      
 
Domain Number 2 Region: 314-496
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.49e-56
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00000123
Further Details:      
 
Domain Number 3 Region: 496-607
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.02e-28
Family HCDH C-domain-like 0.00000562
Further Details:      
 
Domain Number 4 Region: 625-715
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.79e-24
Family HCDH C-domain-like 0.0000507
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37678213|ref|NP_932822.1|
Sequence length 723
Comment multifunctional fatty acid oxidation complex subunit alpha [Vibrio vulnificus YJ016]
Sequence
MIYQAETLQVKEVQDGVAEILFCAQNSVNKLDLATLASLDKALDALTAHSGLKGVMLTSD
KEAFIVGADITEFLGLFAKPEEELDQWLQFANSIFNKLEDLPVPTVAVVKGHTLGGGCEC
VLATDLRIGDKTTSIGLPETKLGIMPGFGGCVRLPRVIGADSAMEIITQGKACRAEEALK
IGLLDAVVDSDRLYASALQTLTDAINEKIDWKARRQQKTSALTLSKLEAMMSFTMAKGLV
AQVAGPHYPAPMTAVVTIEEGARFARNQALDIERKHFVKLAKSEEAKALVGLFLNDQYIK
GIAKKAAKSANKETQRAAVLGAGIMGGGIAYQSALKGVPVIMKDIAQASLDLGMTEASKL
LNKQLERGKIDGFKMAGILASITPSLHYAGIDNADIIVEAVVENPKVKAAVLSEVEEQVS
EETVLTSNTSTIPINLLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGEHTSDETINRVVA
YAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSMLLRDGADFTQIDKVMERKFGWPMGPAY
LLDVVGIDTAHHAQAVMAQGFPERMGKQGRDAIDALFEANKYGQKNGSGFYTYTMDKKGK
PKKAFSDEIVPILAPVCAAQQAFDDQTIIQRMMIPMINEVVLCLQEGIIASAQEADMALV
YGLGFPPFRGGVFRYLDSVGIANFVAMAQQHVELGAMYQVPQMLIDMAERGQTFYGAQQQ
GSI
Download sequence
Identical sequences Q7MQH9
196600.VV0029 WP_011149065.1.34622 gi|37678213|ref|NP_932822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]