SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678214|ref|NP_932823.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678214|ref|NP_932823.1|
Domain Number 1 Region: 5-134
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.17e-43
Family YigZ N-terminal domain-like 0.0000039
Further Details:      
 
Domain Number 2 Region: 139-201
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000000158
Family YigZ C-terminal domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37678214|ref|NP_932823.1|
Sequence length 207
Comment hypothetical protein VV0030 [Vibrio vulnificus YJ016]
Sequence
MNENPYLIPAQAIQFEEEIKKSLFITYLAHTPTIEAAKAFVERIKTQHADARHNCWAFVA
GRPEDSMKWGFSDDGEPSGTAGKPILAQLSGSGVGEITAVVTRYYGGIRLGTGGLVKAYG
GGVQQALKLLQTIEKKITTKLRLELDYAFVPIAQSIMQQFDAVEVDAQYSESVVLVVELE
VRNVEMFTQTMINKSSAKALVTPYIGK
Download sequence
Identical sequences Q7MQH8
196600.VV0030 gi|37678214|ref|NP_932823.1| WP_011149066.1.34622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]