SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678221|ref|NP_932830.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678221|ref|NP_932830.1|
Domain Number 1 Region: 290-489
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.89e-47
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000103
Further Details:      
 
Domain Number 2 Region: 782-1008
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.88e-46
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000361
Further Details:      
 
Domain Number 3 Region: 41-130
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.25e-23
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0011
Further Details:      
 
Domain Number 4 Region: 553-650
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 8.89e-22
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0022
Further Details:      
 
Domain Number 5 Region: 136-181,267-323
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.22e-21
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0042
Further Details:      
 
Domain Number 6 Region: 701-783
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 1.96e-17
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00056
Further Details:      
 
Domain Number 7 Region: 182-263
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 4.71e-17
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37678221|ref|NP_932830.1|
Sequence length 1039
Comment multidrug resistance protein [Vibrio vulnificus YJ016]
Sequence
MRFTDVFIKRPVLAVSISFLIALLGLQAVFKMQVREYPEMTNTVVTVTTSYYGASADLIQ
GFITQPLEQAVAQADNIDYMTSQSVLGKSTITVNMKLNTDPNAALADILAKTNSVRSQLP
KEAEDPTVTMSTGSTTAVLYIGFTSDELSSSQITDYLERVINPQLFTINGVSKVDLYGGL
KYALRVWLDPAKMGALRLTATDVMGVLNANNYQSATGQVTGEFVLYNGSADTQVSNVQEL
ENLVVKSGDGEVIRLGDIAKVTLEKSHDVYRASANGQEAVVAAINAAPSANPINIAADVL
KLLPQLERNLPSNIKMNVMYDSTIAINESIHEVVKTIVEAAVIVLVVITLFLGSFRAVII
PIVTIPLSLIGVAMVMQAMGFSWNLMTLLAMVLAIGLVVDDAIVVLENVDRHIKEGESPF
RAAIIGTREIAVPVIAMTLTLGAVYAPIALMGGITGSLFKEFALTLAGSVFVSGIIALTL
SPMMCSKMLKAHEKPSKFEEKVHHVLDGMTNRYEKMLKAVMDHRPVVIGFALIVFGTLPV
LFKFIPSELAPSEDKGVVMLMGTGPSNANLDYLQNTMNDVNKILSDQPEVEFAQVFTGVP
NSNQAFGLATLKPWSQREASQAEITKRVGGLVSNVPGMAVTAFQMPELPGAGSGLPIQFV
ITTPNSFESLYTIASDILTEVTSSPLFVYSDLDLKYDSATMKIKIDKDKAGAYGVTMQDI
GITLGTMMADGYVNRIDLNGRSYEVIPQVERKWRLNPESMKNYYVRAADGKAVPLGSLIT
IDVIAEPRSLPHFNQLNSATVGAVPSPGTAMGDAINWFENIASSKLPTGYNHDYMGEARQ
FVTEGSALYATFGLALAIIFLVLAIQFESIRDPIVIMVSVPLAICGALIALAWGLATMNI
YSQVGLITLVGLITKHGILICEVAKEEQLHNKRSRIDAVMEAAKVRLRPILMTTAAMIAG
LIPLMYATGAGAAQRFSIGIVIVAGLAIGTLFTLFVLPVIYSYLAEKHKPLPVFVEDKDL
EKLARVDEAKAAQRQIAEQ
Download sequence
Identical sequences A0A1W6M880 Q7MQH1
WP_011079098.1.16238 WP_011079098.1.17874 WP_011079098.1.21633 WP_011079098.1.22778 WP_011079098.1.34622 WP_011079098.1.81460 WP_011079098.1.93668 gi|27364502|ref|NP_760030.1| gi|37678221|ref|NP_932830.1| 196600.VV0037 216895.VV1_1079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]