SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678249|ref|NP_932858.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678249|ref|NP_932858.1|
Domain Number 1 Region: 1-361
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.61e-58
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000289
Further Details:      
 
Domain Number 2 Region: 337-451
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.72e-35
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37678249|ref|NP_932858.1|
Sequence length 451
Comment glutathione reductase [Vibrio vulnificus YJ016]
Sequence
MATHFDYICIGGGSGGIASANRAAMYGAKVALIEAKDLGGTCVNVGCVPKKVMWHGAQIA
EAMSLYAPDYGFDVEVKGFDWSKLVESRQAYIGRIHQSYDRVLGNNKVNVIKGFAKFVDE
KTVEVNGEHYTADHILIAVGGRPTIPNIPGAEYGIDSNGFFDLAEQPKRVAVVGAGYIAV
EIAGVLNALGTETHLFCRKESPLRSFDPMIIDTLVEVMAAEGPTLHTHSVPKEVVKEADG
SLTLHLENGESQNVDQLIWAIGRHPATDAINLSATGVATNERGYIKVDEFQATNVAGIYC
VGDIMEGGIELTPVAVKAGRQLSERLFNNKPNAKMDYDLVPTVVFSHPPIGTIGLSEPEA
IAQYGKENVKVYTSGFTAMYTAVTQHRQPCKMKLVCAGEDEKVVGLHGIGFAVDEMIQGF
GVAMKMGATKADFDSVVAIHPTGSEEFVTMR
Download sequence
Identical sequences A0A1L9KSG8 A0A1W6M7X6 Q7MQE3
WP_011149093.1.100126 WP_011149093.1.21633 WP_011149093.1.22486 WP_011149093.1.22778 WP_011149093.1.25536 WP_011149093.1.34622 WP_011149093.1.53345 WP_011149093.1.54858 WP_011149093.1.55006 WP_011149093.1.59022 WP_011149093.1.66581 WP_011149093.1.73066 WP_011149093.1.78369 WP_011149093.1.8292 WP_011149093.1.8379 WP_011149093.1.89979 WP_011149093.1.90288 WP_011149093.1.93668 WP_011149093.1.94371 gi|37678249|ref|NP_932858.1| 196600.VV0065 gi|320154928|ref|YP_004187307.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]