SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678261|ref|NP_932870.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678261|ref|NP_932870.1|
Domain Number 1 Region: 16-204,353-410
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.43e-59
Family HI0933 N-terminal domain-like 0.000000937
Further Details:      
 
Domain Number 2 Region: 206-354
Classification Level Classification E-value
Superfamily HI0933 insert domain-like 1.01e-43
Family HI0933 insert domain-like 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37678261|ref|NP_932870.1|
Sequence length 410
Comment flavoprotein [Vibrio vulnificus YJ016]
Sequence
MPTAHPFLLSERFSSMSNKFDVVVIGAGAAGLMCAAEAGRRGRKVLVLDHAKKPGRKILI
SGGGRCNFTNNEVSAKNYLCRNPHFVKSALSQYSNWDFISMIYKYGIEFEERDHGQLFCL
DSAKEIVNMLLSECDQPNIAQRYQVLLTEIEKTEQGFVLRAGAEAFECQSLVVATGGLSM
PKLGATPFGYKIAEQFGIPVVPTTAGLVPFTLHKQDKEDFAELSGIAIPAEITAEDGTLF
KEALLFTHRGLSGPAVLQISSYWKAGQAVSINLVPEVDVLELLQRNLEKHPNQSMKNTLA
KVLPKRLVEVLIERNELTDKPLKQYNGKELQEIVEYLEHWKIAPNGTEGYRTAEVTLGGV
DTDYLSSKTMECKTVPGLYFIGEVMDVTGWLGGYNFQWCWSSGFVAGQWV
Download sequence
Identical sequences Q7MQD1
196600.VV0077 gi|37678261|ref|NP_932870.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]