SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678309|ref|NP_932918.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678309|ref|NP_932918.1|
Domain Number 1 Region: 5-319
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.35e-57
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00098
Further Details:      
 
Domain Number 2 Region: 344-463
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.89e-30
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37678309|ref|NP_932918.1|
Sequence length 466
Comment soluble pyridine nucleotide transhydrogenase [Vibrio vulnificus YJ016]
Sequence
MAHANHFDVIVIGSGPGGEGAAMGLTKAGLKVAVVEKESSVGGGCTHWGTIPSKALRHAV
SRIIEFNSNPLFCKNNSSLHATFSTILGHAKSVIDKQTRLRQGFYDRNQCQLIFGTARFT
DAHTISVTQNDGTEEVYTADKFVIATGSRPYQPADVDFNHERIYDSDSILSLKHDPRHII
IYGAGVIGCEYASIFRGLGVKTDLINTRDRLLAFLDNEVSDALSYHFWNSGVVIRNDETY
ERIEGTEDGVIVHLQSGKKMKADCLLYANGRTGNTDKLNLPAVGLQGDSRGQLKVDGNYQ
TEVEHVYAVGDVIGYPSLASAAYDQGRFVAQAITKGKADGYLIDDIPTGIYTIPEISSVG
KTEQELTAAKVPYEVGRSSFKHLARAQIAGKDIGSLKILFHRETKEILGIHCFGERAAEI
IHIGQAIMEQKGEANTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF
Download sequence
Identical sequences A0A087JVA8 A0A0H0XYZ2 A0A1L9KRW8 Q7MQ83 Q8DD46
gi|27364584|ref|NP_760112.1| gi|37678309|ref|NP_932918.1| WP_011079178.1.100126 WP_011079178.1.13374 WP_011079178.1.16238 WP_011079178.1.17874 WP_011079178.1.22486 WP_011079178.1.22778 WP_011079178.1.28215 WP_011079178.1.28571 WP_011079178.1.31968 WP_011079178.1.33883 WP_011079178.1.34622 WP_011079178.1.39407 WP_011079178.1.39524 WP_011079178.1.43691 WP_011079178.1.47396 WP_011079178.1.49981 WP_011079178.1.512 WP_011079178.1.53345 WP_011079178.1.53782 WP_011079178.1.54486 WP_011079178.1.54603 WP_011079178.1.54858 WP_011079178.1.553 WP_011079178.1.58875 WP_011079178.1.58885 WP_011079178.1.59022 WP_011079178.1.59048 WP_011079178.1.59451 WP_011079178.1.60167 WP_011079178.1.60868 WP_011079178.1.61535 WP_011079178.1.63462 WP_011079178.1.63825 WP_011079178.1.65015 WP_011079178.1.66219 WP_011079178.1.66581 WP_011079178.1.67868 WP_011079178.1.73173 WP_011079178.1.78369 WP_011079178.1.79678 WP_011079178.1.81060 WP_011079178.1.81460 WP_011079178.1.81555 WP_011079178.1.82587 WP_011079178.1.8292 WP_011079178.1.84562 WP_011079178.1.86005 WP_011079178.1.86748 WP_011079178.1.89979 WP_011079178.1.90288 WP_011079178.1.93668 WP_011079178.1.94371 WP_011079178.1.95941 WP_011079178.1.96968 WP_011079178.1.9921 WP_011079178.1.99976 196600.VV0126 216895.VV1_1168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]