SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678342|ref|NP_932951.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678342|ref|NP_932951.1|
Domain Number 1 Region: 3-353
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 6.28e-85
Family Iron-containing alcohol dehydrogenase 0.00000000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37678342|ref|NP_932951.1|
Sequence length 362
Comment glycerol dehydrogenase [Vibrio vulnificus YJ016]
Sequence
MLTTTIFPGRYVQGKDARKQLGVELNRFGKKGLMICDSFVYDTLFSEFEPYLETVEVEVI
RFASECCDEEITRLTAMLKNFEGEFVVGLGGGKTIDTAKATSYEARVPVAIVPTLAASDA
PCSALSVIYTQEGEFKRYLFLPQNPNLVLVDTQIIAKAPVRFLIAGIGDALATWFEAESC
QQSFASNMTGYMGSLSAYALARLCYDTLLEYGVIAKTSNEQGVVTPALERVVEANTLLSG
LGFESGGLAASHAIHNGLTVLEPTHVFLHGEKVAFGLLSSLFLTDKPAQTIATVYDFCEK
VGLPTTLSQIGLENVSDEDLLAVAEASCAEGETIHNEPRTVTPDMVFAAMKAANVEGLRR
KS
Download sequence
Identical sequences A0A087JRG3 A0A0H0XUW8 Q7MQ50
gi|37678342|ref|NP_932951.1| WP_011149165.1.34622 WP_011149165.1.54858 WP_011149165.1.58885 WP_011149165.1.59022 WP_011149165.1.6611 WP_011149165.1.78369 WP_011149165.1.79678 WP_011149165.1.81060 WP_011149165.1.8292 WP_011149165.1.84562 WP_011149165.1.89979 196600.VV0158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]