SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678384|ref|NP_932993.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678384|ref|NP_932993.1|
Domain Number 1 Region: 5-211
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-59
Family G proteins 0.00012
Further Details:      
 
Domain Number 2 Region: 155-303
Classification Level Classification E-value
Superfamily Translation proteins 1.04e-35
Family Elongation factors 0.0048
Further Details:      
 
Domain Number 3 Region: 402-516
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.39e-27
Family EF-G/eEF-2 domains III and V 0.0069
Further Details:      
 
Domain Number 4 Region: 306-391
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000000000000335
Family EF-G/eEF-2 domains III and V 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37678384|ref|NP_932993.1|
Sequence length 609
Comment GTP-binding protein TypA [Vibrio vulnificus YJ016]
Sequence
MTTPQIDKLRNIAIIAHVDHGKTTLVDKLLQQSGTLQSRGDVEERVMDSNDIEKERGITI
LAKNTAIRWNDYRINIVDTPGHADFGGEVERIMSMVDCVLLIVDAVDGPMPQTRFVTQKA
FAHGLKPIVVINKIDRPGARPDWVMDQVFDLFDNLGATDEQLDFKVVYASALNGWASLEE
GETGEDMEPLFQTIVDVVDAPNVDLDGPLQMQISQLDYSSYVGVIGVGRVTRGKVKANQQ
VTIVGADGKTRNGKVGTVLGYMGLERHEVEQATAGDIIAITGLGELKISDTICDVNKPEA
LPALSVDEPTVTMTFQVNTSPFAGLEGKYVTSRNILERLEKELVHNVALRVEQTEDPDKF
RVSGRGELHLSILIENMRREGFELAVSRPEVILKEENGQLMEPFETVTIDVQEEHQGGIM
EKIGMRKGELKDMSPDGKGRVRLDFMMPSRGLIGFQTEFMTLTSGSGLLYHTFDHYGPHK
GGNIGQRINGVLIANAAGKALTNALFNLQERGRLFIGHGVEVYEGMVIGIHSRDNDLTVN
ALKGKQLTNVRASGTDDAQVLTPPITMTLEQALEFIDDDELVEVTPENIRIRKKFLTESD
RKRASREAK
Download sequence
Identical sequences A0A087IFL7 A0A0H0Y1I8 A0A1L9KT75 Q7MQ10
196600.VV0200 216895.VV1_0888 gi|37678384|ref|NP_932993.1| gi|27364336|ref|NP_759864.1| gi|320157728|ref|YP_004190107.1| WP_011078955.1.13374 WP_011078955.1.16238 WP_011078955.1.17874 WP_011078955.1.21633 WP_011078955.1.22778 WP_011078955.1.24453 WP_011078955.1.25536 WP_011078955.1.28215 WP_011078955.1.28571 WP_011078955.1.30871 WP_011078955.1.31968 WP_011078955.1.33883 WP_011078955.1.34622 WP_011078955.1.43691 WP_011078955.1.47396 WP_011078955.1.512 WP_011078955.1.53782 WP_011078955.1.54486 WP_011078955.1.54603 WP_011078955.1.55006 WP_011078955.1.553 WP_011078955.1.58885 WP_011078955.1.59048 WP_011078955.1.59451 WP_011078955.1.60167 WP_011078955.1.60868 WP_011078955.1.61535 WP_011078955.1.63462 WP_011078955.1.63825 WP_011078955.1.65015 WP_011078955.1.66219 WP_011078955.1.66581 WP_011078955.1.67868 WP_011078955.1.73066 WP_011078955.1.79678 WP_011078955.1.81460 WP_011078955.1.81555 WP_011078955.1.8379 WP_011078955.1.84562 WP_011078955.1.86005 WP_011078955.1.86748 WP_011078955.1.90288 WP_011078955.1.93668 WP_011078955.1.94371 WP_011078955.1.95941 WP_011078955.1.96968 WP_011078955.1.9921 WP_011078955.1.99976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]