SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678393|ref|NP_933002.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678393|ref|NP_933002.1|
Domain Number 1 Region: 10-107
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 2.36e-32
Family Heat shock protein 15 kD 0.0000562
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37678393|ref|NP_933002.1|
Sequence length 130
Comment ribosome-associated heat shock protein [Vibrio vulnificus YJ016]
Sequence
MTMSSPNEAVRLDKWLWAARFYKTRSIARDMVDGGKVHYNGQRAKPSKIVEVGAVLKLRQ
GNEEKTVVIEKLSTQRRGAPEAQTLYSETQESQAKREAQAMQRKLNAHNPSPDRRPDKKQ
RRDIIKFKHQ
Download sequence
Identical sequences Q7MQ01
196600.VV0209 gi|320157719|ref|YP_004190098.1| gi|37678393|ref|NP_933002.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]