SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678463|ref|NP_933072.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678463|ref|NP_933072.1|
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.6e-45
Family Ribonuclease PH domain 1-like 0.00000329
Further Details:      
 
Domain Number 2 Region: 153-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.14e-25
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37678463|ref|NP_933072.1|
Sequence length 238
Comment ribonuclease PH [Vibrio vulnificus YJ016]
Sequence
MRPNDRAADQVRPIKITRNYTAYAEGSVLVEFGNTKVLCNATVEESVPRWLKGQGKGWVT
AEYGMLPRATHSRTRREAANGKQGGRTMEIQRLIARSLRAVVDLEAMGEFMITVDCDVIQ
ADGGTRTASISGASVAMADAFQHLVDSGKLKANPMKGHVAAVSVGILGEDVLCDLEYVED
SAADTDMNVVMTEEGKMIEIQGTAEGEPFSHEQLLALLESAKKGISEIVAAQKAALAN
Download sequence
Identical sequences A0A087I5Y7 A0A0H0Y1E1 A0A1L9KSW3 Q7MPT3 Q8DDX4
196600.VV0279 216895.VV1_0832 gi|320157673|ref|YP_004190052.1| gi|37678463|ref|NP_933072.1| WP_011078901.1.100126 WP_011078901.1.13374 WP_011078901.1.16238 WP_011078901.1.17874 WP_011078901.1.21633 WP_011078901.1.22486 WP_011078901.1.22778 WP_011078901.1.25536 WP_011078901.1.28215 WP_011078901.1.28571 WP_011078901.1.30871 WP_011078901.1.31968 WP_011078901.1.33883 WP_011078901.1.34622 WP_011078901.1.39407 WP_011078901.1.39524 WP_011078901.1.47396 WP_011078901.1.49981 WP_011078901.1.512 WP_011078901.1.53345 WP_011078901.1.53782 WP_011078901.1.54486 WP_011078901.1.54858 WP_011078901.1.553 WP_011078901.1.58885 WP_011078901.1.59022 WP_011078901.1.59048 WP_011078901.1.59451 WP_011078901.1.60167 WP_011078901.1.60868 WP_011078901.1.61535 WP_011078901.1.63462 WP_011078901.1.65015 WP_011078901.1.66219 WP_011078901.1.66581 WP_011078901.1.67868 WP_011078901.1.73066 WP_011078901.1.73173 WP_011078901.1.78369 WP_011078901.1.78668 WP_011078901.1.79678 WP_011078901.1.81060 WP_011078901.1.81460 WP_011078901.1.82587 WP_011078901.1.8292 WP_011078901.1.8379 WP_011078901.1.84562 WP_011078901.1.86005 WP_011078901.1.86748 WP_011078901.1.89979 WP_011078901.1.90288 WP_011078901.1.93668 WP_011078901.1.94371 WP_011078901.1.95941 WP_011078901.1.96968 WP_011078901.1.9921 WP_011078901.1.99976 gi|27364280|ref|NP_759808.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]