SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678476|ref|NP_933085.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678476|ref|NP_933085.1|
Domain Number 1 Region: 8-162
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 9.65e-46
Family Adenylyltransferase 0.0000082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37678476|ref|NP_933085.1|
Sequence length 164
Comment phosphopantetheine adenylyltransferase [Vibrio vulnificus YJ016]
Sequence
MSKKALSRVVYPGTFDPITNGHLDLIERAAKMFDEVIIAVAASPSKNTMFTLEERVDFAR
QVTRHLDNVTAQGFSGLMVDFARAVDANVLIRGLRTTVDFEYEFGLTNMYRRLLPGLESV
FLTPSEEHAFISSTIVREVAIHGGDVTQFVPTVVAEALHQKKKV
Download sequence
Identical sequences A0A0H0Y5U5 A0A1V8N1R3 Q7MPS0 Q8DDY6
gi|37678476|ref|NP_933085.1| gi|320157661|ref|YP_004190040.1| gi|27364268|ref|NP_759796.1| WP_011078889.1.16238 WP_011078889.1.17874 WP_011078889.1.33883 WP_011078889.1.34622 WP_011078889.1.39524 WP_011078889.1.55006 WP_011078889.1.58885 WP_011078889.1.66581 WP_011078889.1.73066 WP_011078889.1.79678 WP_011078889.1.81460 WP_011078889.1.82587 WP_011078889.1.90288 WP_011078889.1.93668 196600.VV0292 216895.VV1_0819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]