SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678498|ref|NP_933107.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678498|ref|NP_933107.1|
Domain Number 1 Region: 86-347
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 6.68e-67
Family Cytidylytransferase 0.026
Further Details:      
 
Domain Number 2 Region: 8-111
Classification Level Classification E-value
Superfamily CBS-domain pair 2.91e-21
Family CBS-domain pair 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37678498|ref|NP_933107.1|
Sequence length 353
Comment sugar-phosphate nucleotide transferase [Vibrio vulnificus YJ016]
Sequence
MKNNWKKAVLSPDATIKEALRVIDAESLRVALVVDEKGILQGVVTDGDIRRGLLAGKALE
TMLSEVMNRKPITASVSADRDDLIARMNKSDLLFIPLVDGPYLAGLATLHGALVDKPLYQ
NPVFLMAGGFGTRLRPLTDSCPKPMLKIGNKPILETVIRSFIKAGFVNFYISTHYMPELI
HAHFGDGSGFGVNITYVHEESPLGTGGALGLLPKDLPKDLPLIMMNGDVLTKVDFQRLLD
FHVTHDADATMCVREYDYQIPYGVINGEGNKITSMVEKPIQRFFVNAGIYVVSPRVIQSV
PENHRIDMPTLLEQHMQERNNVLMFPIHEYWLDIGRMDDFNRAQADIHTLGLD
Download sequence
Identical sequences Q7MPP8
196600.VV0314 WP_011149287.1.34622 gi|37678498|ref|NP_933107.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]