SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678558|ref|NP_933167.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678558|ref|NP_933167.1|
Domain Number 1 Region: 5-101
Classification Level Classification E-value
Superfamily Ribosomal protein S10 7.06e-37
Family Ribosomal protein S10 0.0000034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37678558|ref|NP_933167.1|
Sequence length 103
Comment 30S ribosomal protein S10 [Vibrio vulnificus YJ016]
Sequence
MQNQRIRIRLKAFDYKLIDASTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKK
ARDQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISLG
Download sequence
Identical sequences A0A034TCD2 A0A034TRX7 A0A061Q7B1 A0A072G5Y7 A0A087I5Q9 A0A099M861 A0A0A3ES24 A0A0A5HNU3 A0A0A5I6K6 A0A0A6QMR6 A0A0B4IMQ1 A0A0C1VMY2 A0A0C1YP78 A0A0C3DEA1 A0A0D1D1M6 A0A0D1ECG1 A0A0D1GLV3 A0A0F2HK12 A0A0F4NM46 A0A0F6LPF2 A0A0G9M6B3 A0A0H0XZG5 A0A0H2NA45 A0A0M0HJV5 A0A0M0HXG0 A0A0M0IPI5 A0A0T7EFV1 A0A151JJL5 A0A177Y204 A0A178JBH8 A0A1B1E921 A0A1L9KZJ7 A0A2A2N9D7 A0A2A9F294 A0A2C6MFJ5 A0A2G5JNH8 A0A2H1B107 A0A2I3CDX8 A0A2K7SQV2 A6B9M4 A7MWI2 A8TC41 B8K699 C9QCX3 D0WTA3 D0X5U1 E3BP36 E8LRD8 E8M0T5 F9T854 H2ICI9 K5TUR0 K5UA36 K5UME3 L8XP63 P66346 P66347 Q7MPI9 S5IPM0 X7R4E7 Z2ECY0
gi|375264285|ref|YP_005021728.1| gi|433656584|ref|YP_007273963.1| gi|37678558|ref|NP_933167.1| gi|543944340|ref|YP_008536796.1| gi|156973050|ref|YP_001443957.1| gi|28897030|ref|NP_796635.1| NP_796635.1.6614 WP_004410492.1.100070 WP_004410492.1.100126 WP_004410492.1.100143 WP_004410492.1.100291 WP_004410492.1.100373 WP_004410492.1.100407 WP_004410492.1.100494 WP_004410492.1.100563 WP_004410492.1.100744 WP_004410492.1.100929 WP_004410492.1.100951 WP_004410492.1.101108 WP_004410492.1.101149 WP_004410492.1.101244 WP_004410492.1.101317 WP_004410492.1.10139 WP_004410492.1.10142 WP_004410492.1.101469 WP_004410492.1.101501 WP_004410492.1.101585 WP_004410492.1.101665 WP_004410492.1.101701 WP_004410492.1.101930 WP_004410492.1.102109 WP_004410492.1.102137 WP_004410492.1.10270 WP_004410492.1.10528 WP_004410492.1.10531 WP_004410492.1.10550 WP_004410492.1.10558 WP_004410492.1.10640 WP_004410492.1.108 WP_004410492.1.10872 WP_004410492.1.10903 WP_004410492.1.1093 WP_004410492.1.10999 WP_004410492.1.11021 WP_004410492.1.11159 WP_004410492.1.11219 WP_004410492.1.11263 WP_004410492.1.11352 WP_004410492.1.11576 WP_004410492.1.11583 WP_004410492.1.11770 WP_004410492.1.11784 WP_004410492.1.12087 WP_004410492.1.12227 WP_004410492.1.12343 WP_004410492.1.12359 WP_004410492.1.12533 WP_004410492.1.12539 WP_004410492.1.12658 WP_004410492.1.12691 WP_004410492.1.12867 WP_004410492.1.1287 WP_004410492.1.12933 WP_004410492.1.12994 WP_004410492.1.130 WP_004410492.1.13068 WP_004410492.1.13071 WP_004410492.1.13374 WP_004410492.1.13482 WP_004410492.1.13548 WP_004410492.1.13595 WP_004410492.1.13632 WP_004410492.1.14008 WP_004410492.1.14200 WP_004410492.1.14243 WP_004410492.1.14261 WP_004410492.1.14593 WP_004410492.1.14638 WP_004410492.1.14943 WP_004410492.1.14974 WP_004410492.1.1499 WP_004410492.1.15114 WP_004410492.1.15169 WP_004410492.1.15178 WP_004410492.1.15211 WP_004410492.1.15258 WP_004410492.1.1535 WP_004410492.1.15419 WP_004410492.1.1555 WP_004410492.1.15563 WP_004410492.1.15699 WP_004410492.1.15831 WP_004410492.1.15887 WP_004410492.1.16021 WP_004410492.1.16073 WP_004410492.1.16091 WP_004410492.1.16138 WP_004410492.1.16148 WP_004410492.1.16176 WP_004410492.1.16230 WP_004410492.1.16238 WP_004410492.1.16304 WP_004410492.1.16503 WP_004410492.1.16556 WP_004410492.1.16663 WP_004410492.1.16742 WP_004410492.1.16983 WP_004410492.1.17331 WP_004410492.1.17519 WP_004410492.1.17580 WP_004410492.1.17642 WP_004410492.1.17874 WP_004410492.1.17941 WP_004410492.1.18029 WP_004410492.1.18078 WP_004410492.1.18167 WP_004410492.1.1836 WP_004410492.1.18388 WP_004410492.1.18397 WP_004410492.1.18767 WP_004410492.1.18807 WP_004410492.1.18931 WP_004410492.1.19074 WP_004410492.1.19108 WP_004410492.1.19198 WP_004410492.1.19647 WP_004410492.1.19755 WP_004410492.1.1977 WP_004410492.1.19947 WP_004410492.1.20092 WP_004410492.1.20186 WP_004410492.1.20389 WP_004410492.1.20403 WP_004410492.1.20539 WP_004410492.1.20587 WP_004410492.1.20749 WP_004410492.1.20786 WP_004410492.1.21030 WP_004410492.1.21130 WP_004410492.1.21357 WP_004410492.1.21927 WP_004410492.1.22008 WP_004410492.1.22207 WP_004410492.1.22486 WP_004410492.1.22509 WP_004410492.1.22672 WP_004410492.1.22832 WP_004410492.1.22854 WP_004410492.1.22903 WP_004410492.1.22951 WP_004410492.1.23210 WP_004410492.1.23232 WP_004410492.1.234 WP_004410492.1.23585 WP_004410492.1.23592 WP_004410492.1.23858 WP_004410492.1.23893 WP_004410492.1.24049 WP_004410492.1.24073 WP_004410492.1.24121 WP_004410492.1.24139 WP_004410492.1.24223 WP_004410492.1.24359 WP_004410492.1.24453 WP_004410492.1.24486 WP_004410492.1.24639 WP_004410492.1.24866 WP_004410492.1.25047 WP_004410492.1.25315 WP_004410492.1.2532 WP_004410492.1.25353 WP_004410492.1.25390 WP_004410492.1.25430 WP_004410492.1.25436 WP_004410492.1.25443 WP_004410492.1.25529 WP_004410492.1.25536 WP_004410492.1.25554 WP_004410492.1.25705 WP_004410492.1.25940 WP_004410492.1.26080 WP_004410492.1.26158 WP_004410492.1.26160 WP_004410492.1.26203 WP_004410492.1.26245 WP_004410492.1.264 WP_004410492.1.26430 WP_004410492.1.26541 WP_004410492.1.266 WP_004410492.1.26610 WP_004410492.1.26685 WP_004410492.1.2670 WP_004410492.1.26700 WP_004410492.1.26729 WP_004410492.1.26870 WP_004410492.1.26889 WP_004410492.1.27000 WP_004410492.1.27033 WP_004410492.1.27116 WP_004410492.1.27229 WP_004410492.1.27256 WP_004410492.1.27269 WP_004410492.1.27277 WP_004410492.1.27385 WP_004410492.1.27450 WP_004410492.1.2772 WP_004410492.1.27735 WP_004410492.1.2802 WP_004410492.1.28215 WP_004410492.1.28278 WP_004410492.1.28415 WP_004410492.1.28422 WP_004410492.1.2846 WP_004410492.1.28571 WP_004410492.1.28753 WP_004410492.1.28858 WP_004410492.1.28926 WP_004410492.1.29024 WP_004410492.1.2908 WP_004410492.1.29144 WP_004410492.1.29193 WP_004410492.1.29398 WP_004410492.1.29695 WP_004410492.1.29713 WP_004410492.1.29784 WP_004410492.1.29832 WP_004410492.1.29877 WP_004410492.1.29928 WP_004410492.1.29975 WP_004410492.1.30183 WP_004410492.1.30198 WP_004410492.1.30244 WP_004410492.1.30327 WP_004410492.1.30649 WP_004410492.1.30734 WP_004410492.1.30764 WP_004410492.1.30871 WP_004410492.1.31008 WP_004410492.1.31179 WP_004410492.1.31234 WP_004410492.1.31267 WP_004410492.1.3137 WP_004410492.1.31447 WP_004410492.1.31513 WP_004410492.1.31628 WP_004410492.1.31646 WP_004410492.1.31722 WP_004410492.1.31746 WP_004410492.1.31765 WP_004410492.1.31813 WP_004410492.1.31829 WP_004410492.1.31961 WP_004410492.1.31968 WP_004410492.1.31998 WP_004410492.1.32165 WP_004410492.1.32180 WP_004410492.1.32328 WP_004410492.1.3237 WP_004410492.1.32508 WP_004410492.1.32528 WP_004410492.1.32539 WP_004410492.1.32616 WP_004410492.1.32765 WP_004410492.1.32844 WP_004410492.1.3289 WP_004410492.1.330 WP_004410492.1.33170 WP_004410492.1.33209 WP_004410492.1.33421 WP_004410492.1.33537 WP_004410492.1.33572 WP_004410492.1.33694 WP_004410492.1.3371 WP_004410492.1.33883 WP_004410492.1.340 WP_004410492.1.34116 WP_004410492.1.3423 WP_004410492.1.3431 WP_004410492.1.34412 WP_004410492.1.34442 WP_004410492.1.34622 WP_004410492.1.3465 WP_004410492.1.34806 WP_004410492.1.34889 WP_004410492.1.3498 WP_004410492.1.35169 WP_004410492.1.35172 WP_004410492.1.35267 WP_004410492.1.35320 WP_004410492.1.35351 WP_004410492.1.3554 WP_004410492.1.35556 WP_004410492.1.35596 WP_004410492.1.35733 WP_004410492.1.35739 WP_004410492.1.35751 WP_004410492.1.35973 WP_004410492.1.36006 WP_004410492.1.36049 WP_004410492.1.36072 WP_004410492.1.36197 WP_004410492.1.36274 WP_004410492.1.36287 WP_004410492.1.36366 WP_004410492.1.36530 WP_004410492.1.36558 WP_004410492.1.36619 WP_004410492.1.36623 WP_004410492.1.36706 WP_004410492.1.36716 WP_004410492.1.36760 WP_004410492.1.36788 WP_004410492.1.3684 WP_004410492.1.3696 WP_004410492.1.36970 WP_004410492.1.36990 WP_004410492.1.36991 WP_004410492.1.37000 WP_004410492.1.37005 WP_004410492.1.37148 WP_004410492.1.37374 WP_004410492.1.37633 WP_004410492.1.37650 WP_004410492.1.37683 WP_004410492.1.37737 WP_004410492.1.37812 WP_004410492.1.37862 WP_004410492.1.37931 WP_004410492.1.38010 WP_004410492.1.3810 WP_004410492.1.38461 WP_004410492.1.38614 WP_004410492.1.38633 WP_004410492.1.38739 WP_004410492.1.38922 WP_004410492.1.39 WP_004410492.1.39142 WP_004410492.1.39181 WP_004410492.1.39328 WP_004410492.1.39379 WP_004410492.1.3940 WP_004410492.1.39407 WP_004410492.1.39524 WP_004410492.1.3961 WP_004410492.1.39756 WP_004410492.1.39791 WP_004410492.1.39826 WP_004410492.1.39842 WP_004410492.1.39849 WP_004410492.1.39910 WP_004410492.1.3995 WP_004410492.1.39977 WP_004410492.1.40020 WP_004410492.1.40049 WP_004410492.1.40051 WP_004410492.1.40181 WP_004410492.1.40273 WP_004410492.1.40328 WP_004410492.1.40386 WP_004410492.1.40625 WP_004410492.1.40684 WP_004410492.1.4076 WP_004410492.1.41062 WP_004410492.1.41224 WP_004410492.1.41234 WP_004410492.1.41418 WP_004410492.1.41441 WP_004410492.1.4157 WP_004410492.1.41816 WP_004410492.1.41966 WP_004410492.1.41993 WP_004410492.1.42025 WP_004410492.1.42059 WP_004410492.1.42061 WP_004410492.1.42185 WP_004410492.1.42292 WP_004410492.1.42393 WP_004410492.1.42776 WP_004410492.1.42785 WP_004410492.1.42858 WP_004410492.1.42872 WP_004410492.1.42884 WP_004410492.1.42890 WP_004410492.1.43067 WP_004410492.1.43162 WP_004410492.1.43185 WP_004410492.1.43257 WP_004410492.1.435 WP_004410492.1.43523 WP_004410492.1.43605 WP_004410492.1.43691 WP_004410492.1.43825 WP_004410492.1.43893 WP_004410492.1.43895 WP_004410492.1.43948 WP_004410492.1.43967 WP_004410492.1.43968 WP_004410492.1.44068 WP_004410492.1.44282 WP_004410492.1.44406 WP_004410492.1.44787 WP_004410492.1.4489 WP_004410492.1.44988 WP_004410492.1.45009 WP_004410492.1.4511 WP_004410492.1.4519 WP_004410492.1.45334 WP_004410492.1.45469 WP_004410492.1.45497 WP_004410492.1.4555 WP_004410492.1.45564 WP_004410492.1.45633 WP_004410492.1.45795 WP_004410492.1.45834 WP_004410492.1.45873 WP_004410492.1.45964 WP_004410492.1.45978 WP_004410492.1.46057 WP_004410492.1.4625 WP_004410492.1.46489 WP_004410492.1.4651 WP_004410492.1.46672 WP_004410492.1.46735 WP_004410492.1.47040 WP_004410492.1.47046 WP_004410492.1.47195 WP_004410492.1.47200 WP_004410492.1.47295 WP_004410492.1.4734 WP_004410492.1.47396 WP_004410492.1.47505 WP_004410492.1.47510 WP_004410492.1.47809 WP_004410492.1.4799 WP_004410492.1.48035 WP_004410492.1.48501 WP_004410492.1.48559 WP_004410492.1.4861 WP_004410492.1.48612 WP_004410492.1.4866 WP_004410492.1.48684 WP_004410492.1.48866 WP_004410492.1.4902 WP_004410492.1.49031 WP_004410492.1.49109 WP_004410492.1.4923 WP_004410492.1.49285 WP_004410492.1.49356 WP_004410492.1.49388 WP_004410492.1.49432 WP_004410492.1.49445 WP_004410492.1.49460 WP_004410492.1.49504 WP_004410492.1.49586 WP_004410492.1.49766 WP_004410492.1.49791 WP_004410492.1.49920 WP_004410492.1.49981 WP_004410492.1.50021 WP_004410492.1.50114 WP_004410492.1.50206 WP_004410492.1.50290 WP_004410492.1.5033 WP_004410492.1.50333 WP_004410492.1.50461 WP_004410492.1.50503 WP_004410492.1.50583 WP_004410492.1.50640 WP_004410492.1.50644 WP_004410492.1.50654 WP_004410492.1.50687 WP_004410492.1.50833 WP_004410492.1.51017 WP_004410492.1.51142 WP_004410492.1.512 WP_004410492.1.51258 WP_004410492.1.51399 WP_004410492.1.51431 WP_004410492.1.51498 WP_004410492.1.51667 WP_004410492.1.51723 WP_004410492.1.51827 WP_004410492.1.51859 WP_004410492.1.51945 WP_004410492.1.51992 WP_004410492.1.5203 WP_004410492.1.52124 WP_004410492.1.52405 WP_004410492.1.52454 WP_004410492.1.5250 WP_004410492.1.52739 WP_004410492.1.5283 WP_004410492.1.52959 WP_004410492.1.52961 WP_004410492.1.53043 WP_004410492.1.53064 WP_004410492.1.53114 WP_004410492.1.53139 WP_004410492.1.53207 WP_004410492.1.5332 WP_004410492.1.53345 WP_004410492.1.53370 WP_004410492.1.53435 WP_004410492.1.53497 WP_004410492.1.53634 WP_004410492.1.53702 WP_004410492.1.53768 WP_004410492.1.53782 WP_004410492.1.53943 WP_004410492.1.54059 WP_004410492.1.54070 WP_004410492.1.54083 WP_004410492.1.5410 WP_004410492.1.54219 WP_004410492.1.54295 WP_004410492.1.54486 WP_004410492.1.54603 WP_004410492.1.54608 WP_004410492.1.5471 WP_004410492.1.54717 WP_004410492.1.54719 WP_004410492.1.54837 WP_004410492.1.54858 WP_004410492.1.54915 WP_004410492.1.54962 WP_004410492.1.55006 WP_004410492.1.55108 WP_004410492.1.55186 WP_004410492.1.55195 WP_004410492.1.55280 WP_004410492.1.553 WP_004410492.1.5530 WP_004410492.1.55333 WP_004410492.1.55354 WP_004410492.1.55429 WP_004410492.1.55435 WP_004410492.1.55548 WP_004410492.1.55593 WP_004410492.1.55759 WP_004410492.1.55855 WP_004410492.1.5595 WP_004410492.1.56068 WP_004410492.1.56123 WP_004410492.1.56134 WP_004410492.1.56138 WP_004410492.1.5619 WP_004410492.1.56232 WP_004410492.1.56677 WP_004410492.1.56715 WP_004410492.1.56836 WP_004410492.1.56842 WP_004410492.1.56899 WP_004410492.1.5699 WP_004410492.1.57128 WP_004410492.1.57129 WP_004410492.1.57237 WP_004410492.1.57263 WP_004410492.1.57332 WP_004410492.1.57390 WP_004410492.1.57523 WP_004410492.1.5768 WP_004410492.1.57729 WP_004410492.1.57773 WP_004410492.1.57934 WP_004410492.1.58071 WP_004410492.1.58214 WP_004410492.1.58273 WP_004410492.1.58356 WP_004410492.1.58536 WP_004410492.1.58614 WP_004410492.1.58748 WP_004410492.1.58791 WP_004410492.1.5882 WP_004410492.1.58875 WP_004410492.1.58885 WP_004410492.1.59022 WP_004410492.1.59048 WP_004410492.1.59184 WP_004410492.1.59403 WP_004410492.1.59451 WP_004410492.1.59528 WP_004410492.1.59578 WP_004410492.1.5962 WP_004410492.1.59650 WP_004410492.1.59672 WP_004410492.1.59786 WP_004410492.1.5980 WP_004410492.1.59835 WP_004410492.1.59887 WP_004410492.1.59902 WP_004410492.1.59926 WP_004410492.1.59976 WP_004410492.1.60037 WP_004410492.1.60089 WP_004410492.1.60090 WP_004410492.1.60100 WP_004410492.1.60167 WP_004410492.1.60172 WP_004410492.1.60533 WP_004410492.1.606 WP_004410492.1.60660 WP_004410492.1.60868 WP_004410492.1.61129 WP_004410492.1.61311 WP_004410492.1.61349 WP_004410492.1.6150 WP_004410492.1.61535 WP_004410492.1.61745 WP_004410492.1.61756 WP_004410492.1.61795 WP_004410492.1.61813 WP_004410492.1.61892 WP_004410492.1.61913 WP_004410492.1.61993 WP_004410492.1.62401 WP_004410492.1.62538 WP_004410492.1.62711 WP_004410492.1.6274 WP_004410492.1.62759 WP_004410492.1.63024 WP_004410492.1.63301 WP_004410492.1.63316 WP_004410492.1.63462 WP_004410492.1.63680 WP_004410492.1.63752 WP_004410492.1.63813 WP_004410492.1.63825 WP_004410492.1.63829 WP_004410492.1.63946 WP_004410492.1.64038 WP_004410492.1.6404 WP_004410492.1.64057 WP_004410492.1.64178 WP_004410492.1.64243 WP_004410492.1.64386 WP_004410492.1.64393 WP_004410492.1.64445 WP_004410492.1.64533 WP_004410492.1.64933 WP_004410492.1.65015 WP_004410492.1.65106 WP_004410492.1.65123 WP_004410492.1.65279 WP_004410492.1.65345 WP_004410492.1.65426 WP_004410492.1.65429 WP_004410492.1.65524 WP_004410492.1.65646 WP_004410492.1.65760 WP_004410492.1.65785 WP_004410492.1.66018 WP_004410492.1.66030 WP_004410492.1.6611 WP_004410492.1.66211 WP_004410492.1.66219 WP_004410492.1.66240 WP_004410492.1.66438 WP_004410492.1.6652 WP_004410492.1.6655 WP_004410492.1.66581 WP_004410492.1.66625 WP_004410492.1.66627 WP_004410492.1.66789 WP_004410492.1.66844 WP_004410492.1.66850 WP_004410492.1.66874 WP_004410492.1.66994 WP_004410492.1.67224 WP_004410492.1.67305 WP_004410492.1.67475 WP_004410492.1.67868 WP_004410492.1.67872 WP_004410492.1.67995 WP_004410492.1.68016 WP_004410492.1.68046 WP_004410492.1.68195 WP_004410492.1.68633 WP_004410492.1.68676 WP_004410492.1.68715 WP_004410492.1.68962 WP_004410492.1.68976 WP_004410492.1.69119 WP_004410492.1.69138 WP_004410492.1.69207 WP_004410492.1.69352 WP_004410492.1.69625 WP_004410492.1.69728 WP_004410492.1.69768 WP_004410492.1.69774 WP_004410492.1.69837 WP_004410492.1.70103 WP_004410492.1.70106 WP_004410492.1.70381 WP_004410492.1.70399 WP_004410492.1.70465 WP_004410492.1.70743 WP_004410492.1.70795 WP_004410492.1.70848 WP_004410492.1.7091 WP_004410492.1.70923 WP_004410492.1.70935 WP_004410492.1.70945 WP_004410492.1.71087 WP_004410492.1.71164 WP_004410492.1.71210 WP_004410492.1.71278 WP_004410492.1.71308 WP_004410492.1.71314 WP_004410492.1.71559 WP_004410492.1.71594 WP_004410492.1.71631 WP_004410492.1.71657 WP_004410492.1.71844 WP_004410492.1.71850 WP_004410492.1.71997 WP_004410492.1.72011 WP_004410492.1.72063 WP_004410492.1.72282 WP_004410492.1.72377 WP_004410492.1.72386 WP_004410492.1.72419 WP_004410492.1.72707 WP_004410492.1.72794 WP_004410492.1.7283 WP_004410492.1.72989 WP_004410492.1.730 WP_004410492.1.73066 WP_004410492.1.73113 WP_004410492.1.73171 WP_004410492.1.73173 WP_004410492.1.7318 WP_004410492.1.7370 WP_004410492.1.73712 WP_004410492.1.73839 WP_004410492.1.73877 WP_004410492.1.74002 WP_004410492.1.74319 WP_004410492.1.74455 WP_004410492.1.74480 WP_004410492.1.74603 WP_004410492.1.74721 WP_004410492.1.74737 WP_004410492.1.7474 WP_004410492.1.74813 WP_004410492.1.74936 WP_004410492.1.75024 WP_004410492.1.75184 WP_004410492.1.75223 WP_004410492.1.75461 WP_004410492.1.75487 WP_004410492.1.75575 WP_004410492.1.75621 WP_004410492.1.76187 WP_004410492.1.76255 WP_004410492.1.763 WP_004410492.1.7630 WP_004410492.1.76318 WP_004410492.1.76423 WP_004410492.1.76704 WP_004410492.1.76725 WP_004410492.1.76821 WP_004410492.1.76917 WP_004410492.1.7709 WP_004410492.1.77322 WP_004410492.1.77366 WP_004410492.1.77374 WP_004410492.1.77412 WP_004410492.1.77537 WP_004410492.1.7760 WP_004410492.1.77748 WP_004410492.1.77954 WP_004410492.1.77981 WP_004410492.1.78137 WP_004410492.1.78237 WP_004410492.1.78369 WP_004410492.1.78441 WP_004410492.1.78619 WP_004410492.1.78624 WP_004410492.1.78668 WP_004410492.1.78812 WP_004410492.1.78839 WP_004410492.1.78886 WP_004410492.1.78902 WP_004410492.1.78935 WP_004410492.1.78964 WP_004410492.1.79102 WP_004410492.1.79136 WP_004410492.1.79195 WP_004410492.1.79225 WP_004410492.1.79678 WP_004410492.1.79694 WP_004410492.1.79702 WP_004410492.1.79711 WP_004410492.1.7973 WP_004410492.1.79742 WP_004410492.1.7976 WP_004410492.1.79894 WP_004410492.1.80140 WP_004410492.1.80241 WP_004410492.1.80498 WP_004410492.1.8069 WP_004410492.1.8080 WP_004410492.1.80922 WP_004410492.1.81014 WP_004410492.1.81050 WP_004410492.1.81060 WP_004410492.1.81130 WP_004410492.1.81205 WP_004410492.1.81246 WP_004410492.1.81334 WP_004410492.1.81454 WP_004410492.1.81460 WP_004410492.1.81537 WP_004410492.1.81555 WP_004410492.1.81646 WP_004410492.1.81752 WP_004410492.1.81753 WP_004410492.1.81782 WP_004410492.1.81805 WP_004410492.1.81887 WP_004410492.1.81992 WP_004410492.1.81998 WP_004410492.1.82047 WP_004410492.1.82060 WP_004410492.1.82387 WP_004410492.1.82587 WP_004410492.1.82618 WP_004410492.1.8274 WP_004410492.1.82791 WP_004410492.1.82801 WP_004410492.1.82806 WP_004410492.1.8292 WP_004410492.1.82938 WP_004410492.1.830 WP_004410492.1.83010 WP_004410492.1.83069 WP_004410492.1.83207 WP_004410492.1.83275 WP_004410492.1.83326 WP_004410492.1.83328 WP_004410492.1.83343 WP_004410492.1.83411 WP_004410492.1.83603 WP_004410492.1.83659 WP_004410492.1.8373 WP_004410492.1.83742 WP_004410492.1.8379 WP_004410492.1.84036 WP_004410492.1.84073 WP_004410492.1.843 WP_004410492.1.84311 WP_004410492.1.84324 WP_004410492.1.84344 WP_004410492.1.84362 WP_004410492.1.84506 WP_004410492.1.84562 WP_004410492.1.84568 WP_004410492.1.84712 WP_004410492.1.84802 WP_004410492.1.84855 WP_004410492.1.84957 WP_004410492.1.84959 WP_004410492.1.85027 WP_004410492.1.85049 WP_004410492.1.85122 WP_004410492.1.85166 WP_004410492.1.85177 WP_004410492.1.8531 WP_004410492.1.85334 WP_004410492.1.85417 WP_004410492.1.8543 WP_004410492.1.85505 WP_004410492.1.85677 WP_004410492.1.85687 WP_004410492.1.85807 WP_004410492.1.85841 WP_004410492.1.85843 WP_004410492.1.86005 WP_004410492.1.86147 WP_004410492.1.86199 WP_004410492.1.86250 WP_004410492.1.86416 WP_004410492.1.86431 WP_004410492.1.8650 WP_004410492.1.86697 WP_004410492.1.86700 WP_004410492.1.86713 WP_004410492.1.86748 WP_004410492.1.86758 WP_004410492.1.86853 WP_004410492.1.8694 WP_004410492.1.8713 WP_004410492.1.87206 WP_004410492.1.87211 WP_004410492.1.8729 WP_004410492.1.87761 WP_004410492.1.87787 WP_004410492.1.88044 WP_004410492.1.88159 WP_004410492.1.88247 WP_004410492.1.88312 WP_004410492.1.88333 WP_004410492.1.8839 WP_004410492.1.88475 WP_004410492.1.88511 WP_004410492.1.88573 WP_004410492.1.88668 WP_004410492.1.88734 WP_004410492.1.88760 WP_004410492.1.88773 WP_004410492.1.88852 WP_004410492.1.8894 WP_004410492.1.89106 WP_004410492.1.89122 WP_004410492.1.89152 WP_004410492.1.89256 WP_004410492.1.89397 WP_004410492.1.89673 WP_004410492.1.89749 WP_004410492.1.89904 WP_004410492.1.89929 WP_004410492.1.89979 WP_004410492.1.90016 WP_004410492.1.90288 WP_004410492.1.90381 WP_004410492.1.90465 WP_004410492.1.90588 WP_004410492.1.90589 WP_004410492.1.90807 WP_004410492.1.90891 WP_004410492.1.91108 WP_004410492.1.91202 WP_004410492.1.91304 WP_004410492.1.91568 WP_004410492.1.9161 WP_004410492.1.91820 WP_004410492.1.91833 WP_004410492.1.91910 WP_004410492.1.92207 WP_004410492.1.92229 WP_004410492.1.92553 WP_004410492.1.92596 WP_004410492.1.92678 WP_004410492.1.92710 WP_004410492.1.92787 WP_004410492.1.92816 WP_004410492.1.92867 WP_004410492.1.93145 WP_004410492.1.93195 WP_004410492.1.93458 WP_004410492.1.93460 WP_004410492.1.93476 WP_004410492.1.93668 WP_004410492.1.93749 WP_004410492.1.9390 WP_004410492.1.93955 WP_004410492.1.93958 WP_004410492.1.93964 WP_004410492.1.93996 WP_004410492.1.94371 WP_004410492.1.94413 WP_004410492.1.94455 WP_004410492.1.94697 WP_004410492.1.94882 WP_004410492.1.9498 WP_004410492.1.9499 WP_004410492.1.95057 WP_004410492.1.95147 WP_004410492.1.95160 WP_004410492.1.95652 WP_004410492.1.95689 WP_004410492.1.95705 WP_004410492.1.95872 WP_004410492.1.95941 WP_004410492.1.96 WP_004410492.1.96035 WP_004410492.1.96237 WP_004410492.1.96264 WP_004410492.1.9642 WP_004410492.1.96444 WP_004410492.1.96491 WP_004410492.1.96723 WP_004410492.1.96734 WP_004410492.1.96879 WP_004410492.1.96968 WP_004410492.1.96981 WP_004410492.1.97023 WP_004410492.1.97071 WP_004410492.1.97299 WP_004410492.1.97304 WP_004410492.1.97440 WP_004410492.1.97446 WP_004410492.1.97659 WP_004410492.1.97811 WP_004410492.1.97950 WP_004410492.1.98178 WP_004410492.1.9827 WP_004410492.1.98496 WP_004410492.1.98507 WP_004410492.1.98725 WP_004410492.1.99004 WP_004410492.1.9921 WP_004410492.1.99239 WP_004410492.1.993 WP_004410492.1.99325 WP_004410492.1.9933 WP_004410492.1.994 WP_004410492.1.99415 WP_004410492.1.99780 WP_004410492.1.99805 WP_004410492.1.99820 WP_004410492.1.99875 WP_004410492.1.99976 150340.VEA_001743 196600.VV0374 216895.VV1_0763 223926.VP0256 338187.VIBHAR_00729 gi|538263585|gb|AGU94786.1| gi|262392517|ref|YP_003284371.1| gi|27364216|ref|NP_759744.1| gi|320157602|ref|YP_004189981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]