SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678559|ref|NP_933168.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678559|ref|NP_933168.1|
Domain Number 1 Region: 1-208
Classification Level Classification E-value
Superfamily Translation proteins 1.94e-83
Family Ribosomal protein L3 0.0000000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37678559|ref|NP_933168.1|
Sequence length 209
Comment 50S ribosomal protein L3 [Vibrio vulnificus YJ016]
Sequence
MIGLIGRKVGMTRVFTEEGVSIPVTVVEVEANRIAQVKTLETDGYAAIQVTAGTKKANRV
NKAEAGHFAKAGVEAGRGLWEFRLENGEEFAVGSELTVELFNEVKKVDVTGTSKGKGFQG
TVKRWNFRTQDMTHGNSLSHRAPGSIGQCQTPGRVFKGKKMAGHMGAERVTTQNLEIVRV
DAERNLLLIKGAVPGATGGNVIVKPAVKA
Download sequence
Identical sequences A0A087J2V1 Q7MPI8
WP_011149347.1.100126 WP_011149347.1.13374 WP_011149347.1.22486 WP_011149347.1.24453 WP_011149347.1.28215 WP_011149347.1.28571 WP_011149347.1.30871 WP_011149347.1.31968 WP_011149347.1.34622 WP_011149347.1.39407 WP_011149347.1.39524 WP_011149347.1.43691 WP_011149347.1.47396 WP_011149347.1.49981 WP_011149347.1.512 WP_011149347.1.53782 WP_011149347.1.54603 WP_011149347.1.54858 WP_011149347.1.553 WP_011149347.1.58875 WP_011149347.1.59022 WP_011149347.1.59048 WP_011149347.1.59451 WP_011149347.1.60167 WP_011149347.1.60868 WP_011149347.1.61535 WP_011149347.1.63462 WP_011149347.1.63825 WP_011149347.1.65015 WP_011149347.1.66219 WP_011149347.1.66581 WP_011149347.1.67868 WP_011149347.1.73173 WP_011149347.1.78369 WP_011149347.1.78668 WP_011149347.1.81060 WP_011149347.1.81555 WP_011149347.1.82587 WP_011149347.1.8292 WP_011149347.1.84562 WP_011149347.1.86005 WP_011149347.1.86748 WP_011149347.1.89979 WP_011149347.1.95941 WP_011149347.1.96968 196600.VV0375 gi|37678559|ref|NP_933168.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]