SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678576|ref|NP_933185.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678576|ref|NP_933185.1|
Domain Number 1 Region: 80-159
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.57e-27
Family Translational machinery components 0.0000313
Further Details:      
 
Domain Number 2 Region: 8-76
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 4.08e-24
Family Ribosomal S5 protein, N-terminal domain 0.0000575
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37678576|ref|NP_933185.1|
Sequence length 167
Comment 30S ribosomal protein S5 [Vibrio vulnificus YJ016]
Sequence
MAKEQQVQANDLQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAA
IQKAMEKARRNMVTIALNEGTLHHPVKGRHSGSKVYMQPAAEGTGVIAGGAMRAVLEVAG
VHNVLSKAYGSTNPINIVRATIDALVDVKSPEMVAAKRGLTVEAISE
Download sequence
Identical sequences A0A087INZ5 A0A099M7Y3 A0A0F2HGS8 A0A0H0Y5N3 A0A151JJ03 A0A1L9KZI7 Q7MPH1 Q8DE57
gi|320157584|ref|YP_004189963.1| gi|37678576|ref|NP_933185.1| gi|27364197|ref|NP_759725.1| WP_011078816.1.100126 WP_011078816.1.101149 WP_011078816.1.13374 WP_011078816.1.16238 WP_011078816.1.17874 WP_011078816.1.21633 WP_011078816.1.22486 WP_011078816.1.22778 WP_011078816.1.24453 WP_011078816.1.25536 WP_011078816.1.28215 WP_011078816.1.28571 WP_011078816.1.30871 WP_011078816.1.31968 WP_011078816.1.33170 WP_011078816.1.33883 WP_011078816.1.34622 WP_011078816.1.37374 WP_011078816.1.39407 WP_011078816.1.39524 WP_011078816.1.43691 WP_011078816.1.47396 WP_011078816.1.49981 WP_011078816.1.512 WP_011078816.1.53345 WP_011078816.1.53782 WP_011078816.1.54486 WP_011078816.1.54603 WP_011078816.1.54858 WP_011078816.1.55006 WP_011078816.1.553 WP_011078816.1.58875 WP_011078816.1.58885 WP_011078816.1.59022 WP_011078816.1.59048 WP_011078816.1.59184 WP_011078816.1.59451 WP_011078816.1.60167 WP_011078816.1.60868 WP_011078816.1.61535 WP_011078816.1.63462 WP_011078816.1.63825 WP_011078816.1.65015 WP_011078816.1.66219 WP_011078816.1.66581 WP_011078816.1.66994 WP_011078816.1.67868 WP_011078816.1.73066 WP_011078816.1.73173 WP_011078816.1.7760 WP_011078816.1.78369 WP_011078816.1.78668 WP_011078816.1.79678 WP_011078816.1.81060 WP_011078816.1.81460 WP_011078816.1.81555 WP_011078816.1.82587 WP_011078816.1.8292 WP_011078816.1.8379 WP_011078816.1.84562 WP_011078816.1.84959 WP_011078816.1.86005 WP_011078816.1.86748 WP_011078816.1.86853 WP_011078816.1.89979 WP_011078816.1.90288 WP_011078816.1.93668 WP_011078816.1.94371 WP_011078816.1.95941 WP_011078816.1.96968 WP_011078816.1.9921 WP_011078816.1.99976 196600.VV0392 216895.VV1_0743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]