SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678582|ref|NP_933191.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678582|ref|NP_933191.1|
Domain Number 1 Region: 3-206
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 1.83e-72
Family Ribosomal protein S4 0.000000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37678582|ref|NP_933191.1|
Sequence length 206
Comment 30S ribosomal protein S4 [Vibrio vulnificus YJ016]
Sequence
MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIDNAPGVHGARRGRLSEYGVQLREKQK
VRRMYGVLEKQFRNYYAEAARLKGNTGENLLQLLEGRLDNVVYRMGFGATRAEARQLVSH
KAILVNGKVVNVPSFKVAANDVVSIREKAKQQTRIKAALEVAEQREKPTWIEVDAGKMEG
TFKRMPERSDLSADINEQLIVELYSK
Download sequence
Identical sequences A0A087I5N4 A0A0H0XZD8 A0A1L9KZP4 Q7MPG5 Q8DE62
WP_011078811.1.100126 WP_011078811.1.13374 WP_011078811.1.16238 WP_011078811.1.17874 WP_011078811.1.21633 WP_011078811.1.22486 WP_011078811.1.22778 WP_011078811.1.24453 WP_011078811.1.25536 WP_011078811.1.28215 WP_011078811.1.28571 WP_011078811.1.30871 WP_011078811.1.31968 WP_011078811.1.33883 WP_011078811.1.34622 WP_011078811.1.39407 WP_011078811.1.39524 WP_011078811.1.43691 WP_011078811.1.47396 WP_011078811.1.49981 WP_011078811.1.512 WP_011078811.1.53345 WP_011078811.1.53782 WP_011078811.1.54486 WP_011078811.1.54603 WP_011078811.1.54858 WP_011078811.1.55006 WP_011078811.1.553 WP_011078811.1.58875 WP_011078811.1.58885 WP_011078811.1.59022 WP_011078811.1.59048 WP_011078811.1.59451 WP_011078811.1.60167 WP_011078811.1.60868 WP_011078811.1.61535 WP_011078811.1.63462 WP_011078811.1.63825 WP_011078811.1.65015 WP_011078811.1.66219 WP_011078811.1.66581 WP_011078811.1.67868 WP_011078811.1.73066 WP_011078811.1.73173 WP_011078811.1.78369 WP_011078811.1.78668 WP_011078811.1.79678 WP_011078811.1.81060 WP_011078811.1.81460 WP_011078811.1.81555 WP_011078811.1.82587 WP_011078811.1.8292 WP_011078811.1.8379 WP_011078811.1.84562 WP_011078811.1.86005 WP_011078811.1.86748 WP_011078811.1.90288 WP_011078811.1.93668 WP_011078811.1.94371 WP_011078811.1.95941 WP_011078811.1.96968 WP_011078811.1.9921 WP_011078811.1.99976 gi|320157577|ref|YP_004189956.1| 196600.VV0398 216895.VV1_0737 gi|37678582|ref|NP_933191.1| gi|27364191|ref|NP_759719.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]