SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678596|ref|NP_933205.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678596|ref|NP_933205.1|
Domain Number 1 Region: 19-234
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7e-59
Family G proteins 0.000000074
Further Details:      
 
Domain Number 2 Region: 332-433
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 6.23e-31
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 242-327
Classification Level Classification E-value
Superfamily Translation proteins 3.53e-24
Family Elongation factors 0.0000396
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37678596|ref|NP_933205.1|
Sequence length 476
Comment sulfate adenylyltransferase subunit 1 [Vibrio vulnificus YJ016]
Sequence
MNSAVQAQLAELGIEGYLNQHQHKSLLRFLTCGSVDDGKSTLIGRLLHDSKQIYEDQLAA
VHSDSQRVGTTGSRPDLALLVDGLQAEREQGITIDVAYRYFSTQKRKFIIADTPGHEQYT
RNMATGASTCDLAVILIDARKGVLDQTRRHSFISNLLGLKHFVVAVNKMDLVEFSQQRFE
EIKAEYLAFSKNLRGETDIQIIPISALEGDNVVELSQQMAWYQGPTLLEILEAVDVEKEK
EAGEFRFPVQYVNRPNLDFRGFAGTISSGVVKVGDRITALPSGKSSTVARIVTFDGDLEQ
AQAGLAVTLTLADEIDISRGDLIVHHGANVELTNHLAADVVWMTEQPLQPGRDYDIKIAG
KKTIGRVEHIHHQYDINNLSKHSAAELPLNGIGLCEWTFNESIALDNYQDCADTGGFIII
DRLTNVTVGAGMVSESLTEVTKASSDFSAFELELNALIRKHFPHWDAKDLSELLKK
Download sequence
Identical sequences A0A2J9Y461 Q7MPF2
196600.VV0412 WP_011149357.1.21633 WP_011149357.1.22778 WP_011149357.1.25536 WP_011149357.1.33883 WP_011149357.1.34622 WP_011149357.1.54486 WP_011149357.1.81460 WP_011149357.1.90288 WP_011149357.1.99976 gi|37678596|ref|NP_933205.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]