SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678626|ref|NP_933235.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678626|ref|NP_933235.1|
Domain Number 1 Region: 280-450
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 2.48e-43
Family MgtE membrane domain-like 0.0001
Further Details:      
 
Domain Number 2 Region: 12-136
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 1.18e-29
Family MgtE N-terminal domain-like 0.002
Further Details:      
 
Domain Number 3 Region: 138-278
Classification Level Classification E-value
Superfamily CBS-domain pair 1.15e-25
Family CBS-domain pair 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37678626|ref|NP_933235.1|
Sequence length 451
Comment magnesium transporter [Vibrio vulnificus YJ016]
Sequence
MAEQIEFDQAHQALQEVSEALENGRFVHVRRQLQDMEPEDIAHLLEASPRKSREVLWQLT
DPEDYGEILDELSEDVKDSLVSKMAPEDLAEATEGMDTDDVAYVLRSLPDNVSREVLAQM
DAADRLRVETALSYSEDTAGGLMNTDVITIRGDVDVDVVLRYLRMKGELPENTDALYVID
EESRLIGELPISILITTQPDVKVSEVMEDVDDAIAVTTSDSDVASLFERRNWISAPVIDE
NQHLVGRITIDDVVDVIREDAEHSMMSMAGLNDDEDTFAPVVKSARKRSIWLGANVLAAL
AAASVSNMFEATLDQMAAIAVLMTIVPSMGGVAGNQTVALVIRGLALGHIGDANKRELLM
KEAAIGFLNGVLWALIIGGIVVAWKGNWLLGGIISAAMMTNLIVAGIAGVTIPILLKKMN
IDPALAGGMALTTVTDVIGLSVFLGLATILI
Download sequence
Identical sequences A0A087INV1 A0A0H0Y130 A0A1L9KZC7 Q7MPC2
gi|320157539|ref|YP_004189918.1| WP_011078775.1.13374 WP_011078775.1.16238 WP_011078775.1.17874 WP_011078775.1.21633 WP_011078775.1.22778 WP_011078775.1.24453 WP_011078775.1.25536 WP_011078775.1.28215 WP_011078775.1.31968 WP_011078775.1.34622 WP_011078775.1.43691 WP_011078775.1.49981 WP_011078775.1.512 WP_011078775.1.53345 WP_011078775.1.53782 WP_011078775.1.54486 WP_011078775.1.54603 WP_011078775.1.55006 WP_011078775.1.553 WP_011078775.1.58875 WP_011078775.1.58885 WP_011078775.1.59048 WP_011078775.1.61535 WP_011078775.1.63825 WP_011078775.1.65015 WP_011078775.1.66219 WP_011078775.1.66581 WP_011078775.1.67868 WP_011078775.1.73066 WP_011078775.1.78668 WP_011078775.1.79678 WP_011078775.1.81060 WP_011078775.1.81460 WP_011078775.1.81555 WP_011078775.1.8379 WP_011078775.1.84562 WP_011078775.1.86005 WP_011078775.1.86748 WP_011078775.1.93668 WP_011078775.1.94371 WP_011078775.1.95941 WP_011078775.1.96968 WP_011078775.1.9921 WP_011078775.1.99976 gi|37678626|ref|NP_933235.1| gi|27364154|ref|NP_759682.1| 196600.VV0442 216895.VV1_0698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]