SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37678685|ref|NP_933294.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678685|ref|NP_933294.1|
Domain Number 1 Region: 76-233
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.74e-31
Family D-ribose-5-phosphate isomerase (RpiA), catalytic domain 0.071
Further Details:      
 
Domain Number 2 Region: 9-70
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000656
Family Transcriptional regulator IclR, N-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37678685|ref|NP_933294.1|
Sequence length 253
Comment sugar metabolism transcriptional regulator [Vibrio vulnificus YJ016]
Sequence
MSKRNTQLRRHSISKLVNEKGEVSVDELAHKFDTSEVTIRKDLASLEKNGQLLRRYGGAI
AIPKEVIHEEMSQNISDRKLKLAEKAAELIRDHNRIVIDSGSTTGALIQQLNSKRGLVVM
TNSLHVANALNELESEPTLLMTGGTWDNHSESFQGKVAESVLRSYDFDQLFIGADGVDLT
RGTTTFNELVGLSKVMAEVSREVIVMVESDKVGRKIPNLELAWEMIDILITNNDLLPEHK
AEMEANGVRVICA
Download sequence
Identical sequences A0A1W6M0V8 Q7MP63
WP_011149415.1.21633 WP_011149415.1.22778 WP_011149415.1.34622 WP_011149415.1.93668 gi|37678685|ref|NP_933294.1| 196600.VV0501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]