SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678688|ref|NP_933297.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678688|ref|NP_933297.1|
Domain Number 1 Region: 205-382
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 5.78e-44
Family Mannitol 2-dehydrogenase 0.0023
Further Details:      
 
Domain Number 2 Region: 3-202
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.34e-42
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37678688|ref|NP_933297.1|
Sequence length 382
Comment mannitol-1-phosphate 5-dehydrogenase [Vibrio vulnificus YJ016]
Sequence
MKNAVHFGAGNIGRGFIGKLLADANVSVTFADVDAPLVDQLSHRQEYKVKVVGSECQIDT
VTHVTAVNSASEEVIDRIVQTDLVTTAVGPNVLDIIAKTIAQGIAKRFAAGNLAPLNIIA
CENMVRGTTHLKGEVYKHLDASLHAQVDELVGFVDSAVDRIVPPAEAANDDPLEVTVESF
SEWIVDEQQFKGEVPSIAGMEKTHNLMAFVERKLFTLNTGHCITAYLGCLQGHRTIREAI
ENPAICDQVKQAMMESGEVLIRRYGFDREMHQAYIEKILARFANPFLVDEVDRVGRQPIR
KLGMNDRLIKPLLGTIEFGTANQHLLKGIAAALKYQNDSDPQAVELQRSLQQVGVKKTLA
KYTSLAEDSVEVAKIETLYNQL
Download sequence
Identical sequences Q7MP60
WP_011149418.1.34622 196600.VV0504 gi|37678688|ref|NP_933297.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]