SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678724|ref|NP_933333.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678724|ref|NP_933333.1|
Domain Number 1 Region: 1-127
Classification Level Classification E-value
Superfamily PTS system fructose IIA component-like 3.79e-35
Family EIIA-man component-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37678724|ref|NP_933333.1|
Sequence length 146
Comment phosphotransferase system, mannose/fructose-specific component IIA [Vibrio vulnificus YJ016]
Sequence
MIGIIVSGHINFATGMQSAVEAIVGEQDSLEFIDFVPTMTTEQLEEQMLSSIEKMNDGSG
VLILTDVPGGSPCNRGVAIMLNRSDVKVVAGCNLPMITNACFERDGVSLAELTEIVCEIG
AQSMKDMAKEIAMLENNNSDSFEDEL
Download sequence
Identical sequences A0A1Q9HII6 A0A1Q9HT34 Q7MP24
196600.VV0540 WP_011149453.1.34622 WP_011149453.1.36074 WP_011149453.1.36396 gi|37678724|ref|NP_933333.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]