SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678766|ref|NP_933375.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678766|ref|NP_933375.1|
Domain Number 1 Region: 25-317
Classification Level Classification E-value
Superfamily Ribokinase-like 7.79e-58
Family Ribokinase-like 0.0043
Further Details:      
 
Domain Number 2 Region: 353-484
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.76e-23
Family Cytidylyltransferase 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37678766|ref|NP_933375.1|
Sequence length 489
Comment bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase [Vibrio vulnificus YJ016]
Sequence
MLHSAQQKNWRPRMKPILPDYNNAGVLIIGDVMLDRYWYGPTSRISPEAPVPVVKVENNE
ERPGGAANVAMNIASLGGHARIVGLTGMDEPAKVLTETLNSLKVKCDFVALPEYPTITKL
RVMSRGQQLIRLDFEDKFEGTNPELVLTRMERALPHVQAVILSDYAKGALEHVEALIAKA
RAANVPVFIDPKGTNFEPYRGATLLTPNMSEFEAVVGKVTSDDDLVEKALGLIEKFELGA
LLVTRSEHGMTLVRPDQKPFHLPTQAKEVYDVTGAGDTVISVLAASVAAGKPLDEACALA
NAAAGVVVGKLGTSTLSTIELAEAIHGSRDTDFGVIAEAALIDAVKAAQAKGEKVVMTNG
CFDILHAGHVSYLNNAAKLGDRLIVAVNTDESVKRLKGPGRPVNPTDRRMAVLAGLGAVD
WVVPFSEDTPQRLISEVLPDLLVKGGDYKPEDIAGGKEVIAAGGEVKVLNFEDGCSTTEI
IDAIKGGRG
Download sequence
Identical sequences 196600.VV0582 gi|37678766|ref|NP_933375.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]