SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678772|ref|NP_933381.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678772|ref|NP_933381.1|
Domain Number 1 Region: 388-619
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.67e-79
Family Type II DNA topoisomerase 0.00014
Further Details:      
 
Domain Number 2 Region: 5-215
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.75e-66
Family DNA gyrase/MutL, N-terminal domain 0.0000000153
Further Details:      
 
Domain Number 3 Region: 217-382
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.65e-46
Family DNA gyrase/MutL, second domain 0.000000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37678772|ref|NP_933381.1|
Sequence length 626
Comment DNA topoisomerase IV subunit B [Vibrio vulnificus YJ016]
Sequence
MTEQYNAGAIEVLNGLEPVRRRPGMYTDTARPNHLGQEVIDNSVDEALAGHASKVQVILH
ADQSLEVIDDGRGMPVDIHPEEKVSGVELILCKLHAGGKFSNKNYQFSGGLHGVGISVVN
ALSKRVEVTVRRDGQVYEIAFEHGDKVSDLTVTGTCGRRNRGTSVHFWPDTKYFDSPNFS
VTRLVNNLRAKAVLCPGLEITFSDRVNGKEHQWLYQDGLKDYLIEGVKGYTLLPEEPFTG
QFSAETEAADWAVIWQPEGGEMITESYVNLIPTAQGGTHVNGLRQGLLDAMREFCEFRNL
LPRGVKLTGEDVFDRCSYVLSVKMQDPQFAGQTKERLSSRQTAAFVSGVVKDTFSLWLNE
KPQLAEQLAEVCIANAHRRMRASKKVVRKKIASGPALPGKLTDCSVQDLARTEIFFVEGD
SAGGSAKQARDREFQAVMPLRGKILNTWEVSADQVLASQEVHDISVALGIDPDSDNLEGL
RYGKICILADADSDGLHIATLLCALFTRHFRALVEAGHIYVAMPPLYRIDCGKEVFYALD
DAEKDGVLERLSQKRAKINVQRFKGLGEMNPLQLRETTMDPNTRRLVQLTIDDSDATMEM
MDMLLGKKRADDRRSWLQNNGDMAEV
Download sequence
Identical sequences A0A0H0Y0L5 A0A1L9KZ16 A0A1V8N0I4 Q7MNX7
gi|27364066|ref|NP_759594.1| gi|320157449|ref|YP_004189828.1| WP_011078690.1.16238 WP_011078690.1.17874 WP_011078690.1.22486 WP_011078690.1.22778 WP_011078690.1.25536 WP_011078690.1.33883 WP_011078690.1.34622 WP_011078690.1.39524 WP_011078690.1.55006 WP_011078690.1.58885 WP_011078690.1.66581 WP_011078690.1.73066 WP_011078690.1.79678 WP_011078690.1.81460 WP_011078690.1.82587 WP_011078690.1.8379 WP_011078690.1.90288 WP_011078690.1.93668 WP_011078690.1.94371 WP_011078690.1.9921 gi|37678772|ref|NP_933381.1| 196600.VV0588 216895.VV1_0606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]