SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678870|ref|NP_933479.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678870|ref|NP_933479.1|
Domain Number 1 Region: 189-324
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 2.14e-45
Family ATP-dependent riboflavin kinase-like 0.00019
Further Details:      
 
Domain Number 2 Region: 30-190
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.38e-33
Family Adenylyltransferase 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37678870|ref|NP_933479.1|
Sequence length 326
Comment bifunctional riboflavin kinase/FMN adenylyltransferase [Vibrio vulnificus YJ016]
Sequence
MTLHKTKTEAFRCIQMELIRGIHNIKPQHRGCVLTIGNFDGVHLGHQEVLRQVSLRAREM
SLPSVVMTFEPQPLELFAKEKAPARLTRLRDKFVQLGKLEIDRLLCVNFNRHFASLDADA
FIRDLLVERLGVKFLVVGDDFCFGKARQGNFAMLQEAGKKYGFTVVNTQSFCLAQLRVSS
TAIREALAHDQLAVAAQMLGRDYSISGRVSHGRKLGRTIGFPTANIPLKRCVSPVSGVYV
VQALGLDNKPIGGVANIGQRPTVNGVRQQLEVHLFDFQANLYGKQLEVVLLHKLRDEKKF
ESFDALKQQIELDAEAARVWLRQLKR
Download sequence
Identical sequences Q7MNM9
gi|37678870|ref|NP_933479.1| 196600.VV0686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]