SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678884|ref|NP_933493.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678884|ref|NP_933493.1|
Domain Number 1 Region: 2-284
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.21e-84
Family NagZ-like 0.000000000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37678884|ref|NP_933493.1|
Sequence length 328
Comment beta-hexosaminidase [Vibrio vulnificus YJ016]
Sequence
MGPLWVDVAGYELNAEDKEILQHPSVGGLILFTRNYHDSEQLLALTAAIRQVVKRPFLIG
VDQEGGRVQRFRDGFSLIPAAAEYAKQANGEAMAQMGGWLMAAELIAHDIDLSFAPVLDQ
GFGCKAIGNRAFGEDTQTILRHSSAYMQGMKAVGMATTGKHFPGHGGVVADSHLETPFDQ
RSDIVEQDMAIFKTQIDAGLLDAMMPAHVIYPHYDPQPASGSEYWLKQVLRQQLGFKGLI
FSDDLTMEGAAVMGGPADRALQALNAGCDMLLMCNKRDAQVAALDALPIVEVPLALSLLK
KRSFSLSELKLAPQWKEARENMLRILGH
Download sequence
Identical sequences A0A0H0Y0C0 Q7MNL5
WP_011149563.1.34622 WP_011149563.1.79678 gi|37678884|ref|NP_933493.1| 196600.VV0700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]