SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678927|ref|NP_933536.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678927|ref|NP_933536.1|
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily CBS-domain pair 1.77e-33
Family CBS-domain pair 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37678927|ref|NP_933536.1|
Sequence length 151
Comment acetoin utilization protein AcuB [Vibrio vulnificus YJ016]
Sequence
MIKVEDMMTRHPHTLLRSHTLGDAKNMMEALDIRHIPVVDANKQLLGIVTQRDLLSAQES
SLHKSSAENSYTAATPLYEVMHTSIMTVEPKAGLKESAIYMQKHKVGCLPVVEKGHLVGI
ITDTDFVTIAINLLELQEEAEPEELEVEDDL
Download sequence
Identical sequences A0A1W6M1F2 Q7MNH4
gi|320157297|ref|YP_004189676.1| gi|37678927|ref|NP_933536.1| 196600.VV0743 WP_011149592.1.16238 WP_011149592.1.21633 WP_011149592.1.22778 WP_011149592.1.25536 WP_011149592.1.34622 WP_011149592.1.55006 WP_011149592.1.58885 WP_011149592.1.66581 WP_011149592.1.73066 WP_011149592.1.81460 WP_011149592.1.8379 WP_011149592.1.90288 WP_011149592.1.93668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]