SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678946|ref|NP_933555.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678946|ref|NP_933555.1|
Domain Number 1 Region: 104-428
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.32e-99
Family Leucine aminopeptidase, C-terminal domain 0.00000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37678946|ref|NP_933555.1|
Sequence length 432
Comment aminopeptidase B [Vibrio vulnificus YJ016]
Sequence
MSTQMSVFLSHEVAAPQWGEKALVSFNEQGALIHTGESTDLTKIQRAARKFDVQGIKSVV
LAGDGWDVEAIWAFHQGYRNPKKYSQLEWVALEEKAQAELEARIKATEFTRDIINKPAEE
VAPRQLATMAAEFIRSVAPEGTVTARIVKDKDLLAEGWEGIYAVGRGSDRTSAMLQLDFN
PTGDENAPVWACLVGKGITFDSGGYSIKASNFMDSMKADMGGSGTITGGLGLAIMRGLNK
RVKLILCCAENMISGRALKLGDVITYKNGKTVEIMNTDAEGRLVLADGLIYASEQNPELI
IDCATLTGAAKNALGNDYHALLTFDQALAQEALKSAAEEKEGLWPLPLAEFHREMLPSNF
ADLSNIGGGDYSPGASTAAAFLSYFVQDYQKGWLHFDCSGTYRKSASDKWSAGATGMGVC
TLANLLVEQANK
Download sequence
Identical sequences A0A0H0Y523 A0A1W6M1H6 Q7MNF5 Q8DEZ4
gi|161501849|ref|NP_759427.2| gi|320157278|ref|YP_004189657.1| gi|37678946|ref|NP_933555.1| 196600.VV0762 216895.VV1_0431 WP_011078530.1.16238 WP_011078530.1.17874 WP_011078530.1.21633 WP_011078530.1.22778 WP_011078530.1.25536 WP_011078530.1.34622 WP_011078530.1.54486 WP_011078530.1.55006 WP_011078530.1.58885 WP_011078530.1.73066 WP_011078530.1.79678 WP_011078530.1.81460 WP_011078530.1.8379 WP_011078530.1.93668 WP_011078530.1.9921 WP_011078530.1.99976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]