SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678947|ref|NP_933556.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678947|ref|NP_933556.1|
Domain Number 1 Region: 1-140
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 1.02e-60
Family Nucleoside diphosphate kinase, NDK 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37678947|ref|NP_933556.1|
Sequence length 141
Comment nucleoside diphosphate kinase [Vibrio vulnificus YJ016]
Sequence
MALERTFSIIKPDAVERNLIGEIYHRIEKAGLRIIAAKMVHLNDEQASGFYAEHEGKEFF
PALKEFMTSGPIMVQVLEGENAIARYRELMGKTNPEEAACGTIRADYALSMRHNSVHGSD
SPASAAREIAFFFPESEICPR
Download sequence
Identical sequences A0A087IHX7 A0A1L9L6B5 Q7MNF4 Q8DEZ5
gi|37678947|ref|NP_933556.1| gi|27363898|ref|NP_759426.1| gi|320157277|ref|YP_004189656.1| 196600.VV0763 216895.VV1_0430 WP_011078529.1.16238 WP_011078529.1.17874 WP_011078529.1.21633 WP_011078529.1.22778 WP_011078529.1.25536 WP_011078529.1.33883 WP_011078529.1.34622 WP_011078529.1.49981 WP_011078529.1.512 WP_011078529.1.53345 WP_011078529.1.54603 WP_011078529.1.55006 WP_011078529.1.58885 WP_011078529.1.60868 WP_011078529.1.61535 WP_011078529.1.63825 WP_011078529.1.65015 WP_011078529.1.66219 WP_011078529.1.66581 WP_011078529.1.67868 WP_011078529.1.73066 WP_011078529.1.78668 WP_011078529.1.81460 WP_011078529.1.8379 WP_011078529.1.84562 WP_011078529.1.86005 WP_011078529.1.90288 WP_011078529.1.93668 WP_011078529.1.94371 WP_011078529.1.95941 WP_011078529.1.9921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]