SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678950|ref|NP_933559.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37678950|ref|NP_933559.1|
Domain Number 1 Region: 265-354
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000000000228
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0064
Further Details:      
 
Domain Number 2 Region: 15-208
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 0.000000000392
Family Dihydropteroate synthetase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37678950|ref|NP_933559.1|
Sequence length 372
Comment 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Vibrio vulnificus YJ016]
Sequence
MHNESPIIRRKSTRIYVGDVPIGDGAPIAVQSMTNTRTTDVAATVAQIKALENVGADIVR
VSVPTMDAAEAFKLIKQQVSIPLVADIHFDYRIALKVAEYGVDCLRINPGNIGNEERIRS
VVDCARDKNIPIRIGVNGGSLEKDLQMKYGEPTPEALVESAMRHVDILDRLNFDQFKVSV
KASDVFLAVDSYRLLAKKIDQPLHLGITEAGGARAGAVKSAVGLGMLLAEGIGDTLRISL
AANPVEEIKVGFDILKSLRIRSRGINFIACPSCSRQEFDVISTVNALEERLEDIITPMDV
SIIGCVVNGPGEAEVSHLGLAGSNKKSAFYEDGKRQKERFDNEDLVNQLEAKIRAKAARM
DESNRIDIKVQN
Download sequence
Identical sequences A0A087IHX4 A0A0H0Y3C2 Q7MNF1 Q8DEZ8
gi|320157274|ref|YP_004189653.1| gi|37678950|ref|NP_933559.1| 196600.VV0766 216895.VV1_0427 WP_011078526.1.13374 WP_011078526.1.16238 WP_011078526.1.17874 WP_011078526.1.21633 WP_011078526.1.22486 WP_011078526.1.22778 WP_011078526.1.24453 WP_011078526.1.25536 WP_011078526.1.28215 WP_011078526.1.28571 WP_011078526.1.30871 WP_011078526.1.31968 WP_011078526.1.33883 WP_011078526.1.34622 WP_011078526.1.39407 WP_011078526.1.39524 WP_011078526.1.43691 WP_011078526.1.47396 WP_011078526.1.49981 WP_011078526.1.512 WP_011078526.1.53782 WP_011078526.1.54486 WP_011078526.1.54603 WP_011078526.1.55006 WP_011078526.1.553 WP_011078526.1.58885 WP_011078526.1.59048 WP_011078526.1.60167 WP_011078526.1.60868 WP_011078526.1.61535 WP_011078526.1.63462 WP_011078526.1.63825 WP_011078526.1.65015 WP_011078526.1.66219 WP_011078526.1.66581 WP_011078526.1.67868 WP_011078526.1.73066 WP_011078526.1.73173 WP_011078526.1.78668 WP_011078526.1.79678 WP_011078526.1.81460 WP_011078526.1.81555 WP_011078526.1.82587 WP_011078526.1.8379 WP_011078526.1.84562 WP_011078526.1.86005 WP_011078526.1.86748 WP_011078526.1.90288 WP_011078526.1.93668 WP_011078526.1.95941 WP_011078526.1.96968 WP_011078526.1.9921 WP_011078526.1.99976 gi|27363895|ref|NP_759423.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]