SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37678958|ref|NP_933567.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|37678958|ref|NP_933567.1|
Domain Number - Region: 151-241
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 0.0387
Family Iron-containing alcohol dehydrogenase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37678958|ref|NP_933567.1|
Sequence length 461
Comment exodeoxyribonuclease VII large subunit [Vibrio vulnificus YJ016]
Sequence
MLCIILRLTSIPTSTGLALSSLTNPNIFTVSRLNSEVRLLLENQLGIVWLVGEISNFSAP
VSGHWYFTLKDSMAQVKCAMFRGNNRLVSFKPTNGNQVLVKARLSLYEPRGDYQLIIESM
QPEGDGRLQQQFDALKMKLASEGLFAQSSKQAIPEHPKCVGIITSKTGAALYDILDVLKR
RDPSLPVVIYPTLVQGEEAAIQIAQAIGRANSRNECDVLIVGRGGGSLEDLWCFNNEIVA
RTIAASQIPIISAVGHEIDVTIADFVADLRAPTPSAAAELVSRDNSHKDQALISREQKLR
AAWRHYLTEQNRTIVSLSHRLEKQHPRYRLMRQTQQADELQIRLQRAMEKYLAQREQKVS
RVQHKLQLLSPVRQISEQKNALARVEQKMMDAMDRKLLRLRHQIAIAAEKLDTVSPLATL
KRGYSITQSESGEVITRQSQIKTGDTLVTRLSDGEIRSTVN
Download sequence
Identical sequences 196600.VV0774 gi|37678958|ref|NP_933567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]