SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679002|ref|NP_933611.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679002|ref|NP_933611.1|
Domain Number 1 Region: 9-139
Classification Level Classification E-value
Superfamily Small protein B (SmpB) 7.85e-48
Family Small protein B (SmpB) 0.0000867
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37679002|ref|NP_933611.1|
Sequence length 161
Comment SsrA-binding protein [Vibrio vulnificus YJ016]
Sequence
MAKKNSKPKAGSNTIALNKKARHEYFIEDEIEAGMELQGWEVKALRQGKANISESYVFMR
DGEAFVSGMTITPLNQASTHVVANPTRVRKLLMSRRELDNLLGRINREGMTLAALSLYWA
RSWVKIKIGVAKGKKLHDKRDDIKDRDWQRQKARVMKSSLR
Download sequence
Identical sequences A0A0H0Y565 A0A1L9L6C7 A0A1V8N023 Q7MN99 Q8DF53
196600.VV0818 216895.VV1_0371 gi|37679002|ref|NP_933611.1| gi|320157244|ref|YP_004189623.1| gi|27363840|ref|NP_759368.1| WP_011078466.1.16238 WP_011078466.1.17874 WP_011078466.1.21633 WP_011078466.1.22486 WP_011078466.1.22778 WP_011078466.1.25536 WP_011078466.1.33883 WP_011078466.1.34622 WP_011078466.1.39524 WP_011078466.1.53345 WP_011078466.1.54486 WP_011078466.1.55006 WP_011078466.1.58885 WP_011078466.1.66581 WP_011078466.1.73066 WP_011078466.1.73173 WP_011078466.1.79678 WP_011078466.1.81460 WP_011078466.1.82587 WP_011078466.1.8379 WP_011078466.1.90288 WP_011078466.1.93668 WP_011078466.1.94371 WP_011078466.1.9921 WP_011078466.1.99976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]