SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679031|ref|NP_933640.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679031|ref|NP_933640.1|
Domain Number 1 Region: 1091-1348
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.23e-97
Family Class I glutamine amidotransferases (GAT) 0.00000000436
Further Details:      
 
Domain Number 2 Region: 673-870
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 7.06e-69
Family PurM N-terminal domain-like 0.0000000337
Further Details:      
 
Domain Number 3 Region: 275-482
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 1.22e-65
Family PurM N-terminal domain-like 0.00000000873
Further Details:      
 
Domain Number 4 Region: 486-669
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 7.48e-54
Family PurM C-terminal domain-like 0.0000000355
Further Details:      
 
Domain Number 5 Region: 879-1089
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 3.29e-53
Family PurM C-terminal domain-like 0.000000104
Further Details:      
 
Domain Number 6 Region: 54-205
Classification Level Classification E-value
Superfamily PurS-like 2.14e-51
Family FGAM synthase PurL, PurS-like domain 0.00000428
Further Details:      
 
Domain Number 7 Region: 209-274
Classification Level Classification E-value
Superfamily FGAM synthase PurL, linker domain 7.98e-22
Family FGAM synthase PurL, linker domain 0.0000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37679031|ref|NP_933640.1|
Sequence length 1351
Comment phosphoribosylformylglycinamidine synthase [Vibrio vulnificus YJ016]
Sequence
MTQTVAFGVTSQKQLLYNAPATERCNRHKFEVKQYNPLNLFQYHLNQLHKRPKHMRILRG
SPALSEFRVNKLLELCREQDLPVTGIYAEFMHFADLTSELDAEALEKLEKLLTYGPTIEE
HEPQGLLLLVTPRPGTISPWSSKATDIAQNCGLNAVKRLERGTAYYVESSSELSSVQIDI
VKSIIHDRMMEAVFGDLEAAAALFSVAQPAPMTQVDILSGGRLALEEANVSLGLALAEDE
IDYLVENFTKLGRNPNDIELMMFAQANSEHCRHKIFNADWTIDGVEQPKSLFKMIKNTFE
TTPDHVLSAYKDNAAVMTGSKVGRFFPDPETRQYNYHHEDAHILMKVETHNHPTAISPWP
GASTGSGGEIRDEGATGIGGKPKAGLVGFTTSNLRIPGFEQPWETDFGKPGRIVNALDIM
LEGPLGGAAFNNEFGRPNLLGYFRTYEEKVTSHAGEEVRGYHKPIMIAGGMGNIRDEHVQ
KKEIPVGASLIVLGGPAMNIGLGGGAASSMASGQSAEDLDFASVQRENPEMERRCQEVID
RCWQLGDNNPIAFIHDVGAGGISNALPELVNDGERGGKFQLRDVPNDEPGMSPLEIWCNE
SQERYVLAVAPENMAAFDAICKRERAPYAVVGVATEERHLTLEDAHFDNTPIDMPMDILL
GKPPKMHREATTLKVDSPAMTRDGIELNEAVDRVLRLPTVAEKTFLITIGDRTVTGLVAR
DQMVGPWQVPVANCAVTAASYDTYHGEAMSMGERTPVALLDFGASARLAVGESLTNIAAT
DIGDIKRIKLSANWMSPAGHPGEDAGLYEAVKAVGEELCPALGLTIPVGKDSMSMKTKWN
ENGEEKEVTSPLSLIITAFARVEDVRKTITPQLRTDKGETSLVLVDLGNGKNRLGATALA
QVYKQLGDKPADVDNAEQLKGFFDAMQALVRQDKLLAYHDKGDGGLLVTLAEMAFAGHCG
VNANIAALGDDVLAALFNEELGAVVQVKNDELDSVLSTLAANGLEACSHVIGAIDASDNF
VIRSGDVVVLERSRTDLRVIWAETTHKMQALRDNPACADQEFEAKKDNSDPGLNVSLSYE
VNEDIAAPYIAKGAKPKMAILREQGVNSHVEMAAAFDRAGFEATDIHMSDILTGQAVLDE
YHGLVACGGFSYGDVLGAGEGWAKSVLFNAQAREQFQAFFNRENTFSLGVCNGCQMLSNL
KELIPGADLWPRFVRNESERFEARFSLVEVQKSDSVFFDGMAGSRMPIAVSHGEGRVEVR
DAQHLAAIEASGTVAVRFVDNLGNPTQQYPNNPNGSPNAITGLTTKDGRVTIMMPHPERV
FRTVANSWAPEGWGENGAWMRMFQNARKNLA
Download sequence
Identical sequences gi|37679031|ref|NP_933640.1| 196600.VV0847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]