SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679034|ref|NP_933643.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679034|ref|NP_933643.1|
Domain Number 1 Region: 20-318
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.3e-76
Family AstE/AspA-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37679034|ref|NP_933643.1|
Sequence length 352
Comment deacylase [Vibrio vulnificus YJ016]
Sequence
MVRIKKNKVFEILGHKIPPAQRLEIELDAAQLYTHSPLSIPIEIINGRNAGPVLMINAAI
HGDELNGVEIVRQLINSLDPNQIKGTVIAVPIVNVFGFIHKSRYLPDRRDLNRCFPGSEK
GALASRMAHTFFSNVALRADYILDLHTGAIHRTNLPQIRANLSNPETLRIAKAFGAPVII
DSALRDGSIRSEAEKCDIPVLTYEAGEALRFDPLSISAGVLGVKRVMQAIGMLRASRKKL
PQPVIAKSTSWVRASGNGILRTVVNLGAKVEKGETLAYISSPLGHDEVELKAPKGGIVIG
QQTLPLVNEGDAIFNVAYFRQDDEVVEQVVESYIEELVESDIDLITTGQIPL
Download sequence
Identical sequences A0A087JMR1 A0A0H0Y3X5 A0A1L9L6G7 Q7MN67
gi|37679034|ref|NP_933643.1| WP_011078437.1.100126 WP_011078437.1.13374 WP_011078437.1.17874 WP_011078437.1.21633 WP_011078437.1.22486 WP_011078437.1.22778 WP_011078437.1.28215 WP_011078437.1.28571 WP_011078437.1.30871 WP_011078437.1.31968 WP_011078437.1.33883 WP_011078437.1.34622 WP_011078437.1.39407 WP_011078437.1.39524 WP_011078437.1.43691 WP_011078437.1.47396 WP_011078437.1.49981 WP_011078437.1.512 WP_011078437.1.53345 WP_011078437.1.53782 WP_011078437.1.54486 WP_011078437.1.54858 WP_011078437.1.55006 WP_011078437.1.553 WP_011078437.1.58875 WP_011078437.1.58885 WP_011078437.1.59022 WP_011078437.1.59451 WP_011078437.1.60167 WP_011078437.1.60868 WP_011078437.1.61535 WP_011078437.1.63825 WP_011078437.1.65015 WP_011078437.1.66219 WP_011078437.1.66581 WP_011078437.1.67868 WP_011078437.1.73173 WP_011078437.1.78369 WP_011078437.1.78668 WP_011078437.1.79678 WP_011078437.1.81060 WP_011078437.1.81555 WP_011078437.1.82587 WP_011078437.1.8292 WP_011078437.1.8379 WP_011078437.1.84562 WP_011078437.1.86005 WP_011078437.1.86748 WP_011078437.1.89979 WP_011078437.1.90288 WP_011078437.1.93668 WP_011078437.1.94371 WP_011078437.1.96968 WP_011078437.1.9921 WP_011078437.1.99976 196600.VV0850 216895.VV1_0336 gi|27363809|ref|NP_759337.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]