SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679035|ref|NP_933644.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|37679035|ref|NP_933644.1|
Domain Number - Region: 122-168
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.043
Family Glycosyl hydrolases family 16 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37679035|ref|NP_933644.1|
Sequence length 179
Comment hypothetical protein VV0851 [Vibrio vulnificus YJ016]
Sequence
MKKTITKVVALSVAAMALSGCVGSNAVTGYVMGFNLKAVDNRYARGGLNMLLAPVYGVAI
AADYIVFNSLEFWTGKNPLNGKPHIFDTKMDTYIDVNHQLDKSLTTAPIAPLTNNRIIEQ
GMMQQIDENTVQMDITYNNGEKATLTGVREGDFVTYYIDGEVVAQTSMDELAAYAQNRA
Download sequence
Identical sequences A0A087I8W9 A0A0H0Y315 A0A1L9L6H0 Q7MN66
gi|320157215|ref|YP_004189594.1| 196600.VV0851 WP_011149672.1.100126 WP_011149672.1.16238 WP_011149672.1.21633 WP_011149672.1.22486 WP_011149672.1.22778 WP_011149672.1.24453 WP_011149672.1.25536 WP_011149672.1.28571 WP_011149672.1.30871 WP_011149672.1.33883 WP_011149672.1.34622 WP_011149672.1.39524 WP_011149672.1.43691 WP_011149672.1.47396 WP_011149672.1.49981 WP_011149672.1.512 WP_011149672.1.53345 WP_011149672.1.54486 WP_011149672.1.54858 WP_011149672.1.55006 WP_011149672.1.58875 WP_011149672.1.58885 WP_011149672.1.59022 WP_011149672.1.59048 WP_011149672.1.59451 WP_011149672.1.60167 WP_011149672.1.60868 WP_011149672.1.61535 WP_011149672.1.63462 WP_011149672.1.63825 WP_011149672.1.65015 WP_011149672.1.66219 WP_011149672.1.66581 WP_011149672.1.67868 WP_011149672.1.73066 WP_011149672.1.73173 WP_011149672.1.78369 WP_011149672.1.78668 WP_011149672.1.79678 WP_011149672.1.81060 WP_011149672.1.81460 WP_011149672.1.82587 WP_011149672.1.8292 WP_011149672.1.8379 WP_011149672.1.84562 WP_011149672.1.86005 WP_011149672.1.89979 WP_011149672.1.90288 WP_011149672.1.93668 WP_011149672.1.94371 WP_011149672.1.95941 WP_011149672.1.96968 WP_011149672.1.9921 WP_011149672.1.99976 gi|37679035|ref|NP_933644.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]