SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679036|ref|NP_933645.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679036|ref|NP_933645.1|
Domain Number 1 Region: 15-186,401-486
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.83e-62
Family Bacterial dinuclear zinc exopeptidases 0.0046
Further Details:      
 
Weak hits

Sequence:  gi|37679036|ref|NP_933645.1|
Domain Number - Region: 206-293
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00144
Family Bacterial exopeptidase dimerisation domain 0.012
Further Details:      
 
Domain Number - Region: 247-387
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0488
Family Bacterial exopeptidase dimerisation domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37679036|ref|NP_933645.1|
Sequence length 490
Comment aminoacyl-histidine dipeptidase [Vibrio vulnificus YJ016]
Sequence
MSEFHSEISTLSPAPLWQFFDKICSIPHPSKHEEALAQYIVNWATEQGLDVRRDPTGNVF
IKKPATPGMENKKGVVLQAHIDMVPQKNEDTQHDFTTDPIRPYIDGEWVTAEGTTLGADN
GIGMASCLAVLASTEIKHGPIEVLLTIDEEAGMTGAFGLEAGWLEGDILLNTDSEQEGEV
YMGCAGGIDGAMTFDIQREAVPAGFITRQLTLKGLKGGHSGCDIHTGRGNANKLMARFLA
GHAQELDLRLVEFRGGSLRNAIPREAFVKVALPAENQDKLAQLFDYYTELLKTELGKVET
NIVTFNQAVDVEAGVLTNADQQRFVAALNACPNGVIRMSDEIEGVVETSLNVGVITTEEN
KITVLCLIRSLIDSGRSQVESMLTSVAELAGAHIVFSGAYPGWKPDADSEIMAIFRDMYE
GIYGHKPNIMVIHAGLECGLFKKPYPDMDMVSFGPTIKFPHSPDEKVKIDTVQLYWDQMV
ALLEAIPEKA
Download sequence
Identical sequences Q7MN65
WP_011149673.1.16238 WP_011149673.1.33883 WP_011149673.1.34622 WP_011149673.1.9921 196600.VV0852 gi|37679036|ref|NP_933645.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]