SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679047|ref|NP_933656.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679047|ref|NP_933656.1|
Domain Number 1 Region: 13-217
Classification Level Classification E-value
Superfamily YrdC/RibB 7.33e-88
Family 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB 0.0000008
Further Details:      
 
Domain Number 2 Region: 220-382
Classification Level Classification E-value
Superfamily RibA-like 4.45e-48
Family RibA-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37679047|ref|NP_933656.1|
Sequence length 384
Comment 3,4-dihydroxy-2-butanone 4-phosphate synthase [Vibrio vulnificus YJ016]
Sequence
MSISVLALKLTGNIAMPISTPQEIIEDIRLGKMVILMDDEDRENEGDLIMAAEHITPEAI
NFMAKYGRGLICLTMTKERCQRLGLPPMVQDNNAQYTTNFTVSIEAAEGVTTGISAADRA
RTVQAAVAKEAKAADLVQPGHIFPLAAQDGGVLTRAGHTEAGCDLARLAGFEPASVIVEI
LNDDGTMARRPDLEVFAEQHGLKLGTIADLIEYRNNTETTIERVAECKLPTEFGEFDLVT
YRDTIDNQIHFALRKGTVGDQTPLVRVHLQDTFTDLLRSDRNAERSWTLDKAMKRIGQEG
GVLVILGNEESPELLIHRVKMFEAQDKEEAPKLAKKQGTSRRVGVGSQILADLGVHDMRL
LSSSNKKYHALGGFGLNVIEYVCE
Download sequence
Identical sequences Q7MN54
gi|37679047|ref|NP_933656.1| 196600.VV0863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]