SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679050|ref|NP_933659.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679050|ref|NP_933659.1|
Domain Number 1 Region: 153-315
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 1.36e-35
Family PurM C-terminal domain-like 0.0000888
Further Details:      
 
Domain Number 2 Region: 15-149
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 9.42e-33
Family PurM N-terminal domain-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37679050|ref|NP_933659.1|
Sequence length 334
Comment thiamine monophosphate kinase [Vibrio vulnificus YJ016]
Sequence
MLAFFITKERILMSGEFNLIEKYFVGRQAQRKDVHLAAGDDCALVKPPSNVQIAISTDTL
VCGTHFLADADPAWVAHKALASNISDLAAMGATPAWVSFALTMPQADEAWLAPFCDGFFK
LADYFGIQLIGGDTTKGPLSLTMTVQGFVPEGKAITRSGAKPGDYVFVTGTLGDAKAGLD
VILDSNLRTRPAAQALEKAHYMSMPRILAGQALVGLASAAIDISDGLIADLGHILNRSQV
GVSLDVSKLPISSELLSFLTERETALQYALTSGEEYELCFTVPEEARGTIESALAHVGCK
VTCIGQIRPHGFFELHDDGTKLNWDLSGFDHFKA
Download sequence
Identical sequences Q7MN51
gi|37679050|ref|NP_933659.1| WP_011149681.1.21633 WP_011149681.1.22778 WP_011149681.1.34622 WP_011149681.1.53345 WP_011149681.1.54486 WP_011149681.1.58885 WP_011149681.1.66581 WP_011149681.1.79678 WP_011149681.1.90288 WP_011149681.1.94371 WP_011149681.1.9921 WP_011149681.1.99976 196600.VV0866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]