SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679095|ref|NP_933704.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679095|ref|NP_933704.1|
Domain Number 1 Region: 4-226,415-666
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.17e-146
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000441
Further Details:      
 
Domain Number 2 Region: 226-414
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 4.92e-56
Family ValRS/IleRS/LeuRS editing domain 0.0000118
Further Details:      
 
Domain Number 3 Region: 660-856
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 3.55e-34
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37679095|ref|NP_933704.1|
Sequence length 857
Comment leucyl-tRNA synthetase [Vibrio vulnificus YJ016]
Sequence
MQEQYNPQDIEQKVQQHWDNNKTFVVTEDPTKEKFYCLSMFPYPSGRLHMGHVRNYTIGD
VVSRFQRLQGKNVMQPIGWDAFGLPAENAAVKNNTAPAPWTYENIEYMKNQLKLLGFGYD
WNREFATCTPEYYRWEQEFFTKLYQKGLVYKKTSSVNWCPNDQTVLANEQVEDGCCWRCD
TPVEQKEIPQWFIKITEYAQELLDDLDTLEGWPEMVKTMQRNWIGRSEGVELKFEVKGQQ
DLEVYTTRPDTLMGVTYVGIAAGHPLAKIAAENNPDLAAFIEECKNTKVAEAELATMEKK
GMATGLTAIHPLNGREVPVYVANFVLMDYGTGAVMAVPAHDQRDFEFATKYGLDIIPVIK
PIDGSELDISEAAYTEKGVLFDSGEFDGLEFQAAFDAIAAKLEAEGKGTKTVNFRLRDWG
VSRQRYWGAPIPMVTTEDGQVHPVPADQLPVILPEDVVMDGVTSPIKADKEWAKTTFNGE
PALRETDTFDTFMESSWYYARYCSPQADDILDPEKANYWLPVDQYIGGIEHACMHLLYSR
FFHKLLRDAGYVTSDEPFKQLLCQGMVLADAFYYTNDKGGKEWVSPTEVKVERDGKGRIT
SAVDNEGRNVEHSGMIKMSKSKNNGIDPQEMVDKYGADTVRLFMMFASPADMTLEWQESG
VEGANRFLKRVWKLVNEHTSKGAAEAVNAAALSGDQKALRRDVHKTIAKVTDDVARRQTF
NTAIAAVMELMNKLAKAPQESAQDRAILDEALKAVVAMLYPITPHICFEMWTALGQQDID
NASWPTYDEQALVEDEKLIVVQVNGKVRGKITVAADATKEQVEEIGLNEENVSKHLDGVT
IRKVIYVPGKLLSIVAN
Download sequence
Identical sequences Q7MN06
gi|37679095|ref|NP_933704.1| WP_011149711.1.34622 196600.VV0911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]