SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679098|ref|NP_933707.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679098|ref|NP_933707.1|
Domain Number 1 Region: 72-214
Classification Level Classification E-value
Superfamily CBS-domain pair 2.2e-33
Family CBS-domain pair 0.0015
Further Details:      
 
Domain Number 2 Region: 216-297
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3e-23
Family CorC/HlyC domain-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37679098|ref|NP_933707.1|
Sequence length 306
Comment hemolysin [Vibrio vulnificus YJ016]
Sequence
MCAITHLIALLNRETMNDDNSQNSEGPSRKSFFGRLGQLFQGEPKDRQELVDVIRDSEVN
DLIDHDTRDMLEGVMEIAEMRVRDIMIPRSQMVTIERKDNLDSLIALITDAQHSRYPVIS
EDKDHVEGILLAKDLLKYLGSDSAPFDIEEVIRPAVVVPESKRVDRLLKEFRQERYHMAI
VVDEFGGVSGLVTIEDILEEIVGDIEDEFDEEEDADIRKLSKHTYAVKALTTIEEFNETF
GSRFSDEEVDTVGGLVMTAFGHLPTRGEIVEIDGFNFKVTAADNRRVIQLQVTVPDSVSV
AETTPE
Download sequence
Identical sequences Q7MN03
gi|37679098|ref|NP_933707.1| 196600.VV0914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]