SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679122|ref|NP_933731.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679122|ref|NP_933731.1|
Domain Number 1 Region: 66-227
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.04e-38
Family Pseudouridine synthase RsuA/RluD 0.0003
Further Details:      
 
Domain Number 2 Region: 8-61
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.0000000000000118
Family Ribosomal protein S4 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37679122|ref|NP_933731.1|
Sequence length 347
Comment 16S rRNA uridine-516 pseudouridylate synthase [Vibrio vulnificus YJ016]
Sequence
MSQDNAKRLNKYISETGFCSRREADKLIEQGRVTINGKQPEMGTKVLPGDDVCVDGKPVA
AKEKPVYIALNKPTGITCTTERNIPGNIVDFIGHKKRIFPIGRLDKPSDGLIFLTNDGDI
VNKILRAGNHHEKEYVVRVDKPITPEFIKAMSSGVNILDTVTLPCKVTQETKFSFRIVLT
QGLNRQIRRMCEALGYEVFKLRRVRIMNISLDGIPNGKWRYLTDDEVTEILAMCEGSVGT
EEASRVDAKGRRIRKATDAKLFDSREENQTSTARRNQKQRTFKGNNADEFRHAPNSKKAQ
QRKQQDGDKPRFEKPKRQEQAGKAKRYDNPNAAKPVKRTGGTLTLKK
Download sequence
Identical sequences A0A1W6M1Y8 Q7MMX9
WP_011149733.1.33883 WP_011149733.1.34622 WP_011149733.1.39407 WP_011149733.1.58885 WP_011149733.1.93668 gi|37679122|ref|NP_933731.1| 196600.VV0938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]