SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679133|ref|NP_933742.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679133|ref|NP_933742.1|
Domain Number 1 Region: 3-301
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.22e-108
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000164
Further Details:      
 
Domain Number 2 Region: 302-464
Classification Level Classification E-value
Superfamily An anticodon-binding domain of class I aminoacyl-tRNA synthetases 4.58e-47
Family C-terminal domain of glutamyl-tRNA synthetase (GluRS) 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37679133|ref|NP_933742.1|
Sequence length 474
Comment glutamyl-tRNA synthetase [Vibrio vulnificus YJ016]
Sequence
MTVKTRFAPSPTGYLHVGGARTALYSWLYAKSQGGEFVLRIEDTDLERNSQEAVDAILEG
MQWLGLEWNEGPYFQTQRFDRYNEMVDKLLAEDKAYKCYASKELLDEVRAEQEANKEMPR
YDAEHPKIKAANEAAKDGDPCVIRFRNPKEGSVVFEDQIRGRIEISNSQMDDLIIRRTDG
SPTYNFCVVVDDWDMGITHVIRGEDHINNTPRQINIYEALGAPVPTFAHCAMILGDDGAK
LSKRHGAVSVMQYRDMGYLPVALNNYLVRLGWSHGDQEIFSQEEMINLFSLNAISKSASA
FNTDKLLWLNNHYIKTSDPKYVAEHLQWHLDQKDIKTENGPAITDVIKLVGERCNTLVEL
ADQIGYFYQDFDAFDADAAKKHLRGVAKQPLEVALAKVEALTEWTTENLHQVIADVCTDL
EIGMGKIGMPLRVAVTGGGQSPSVDAVMQLIGKERVVARIKMALAFIAEREANA
Download sequence
Identical sequences Q7MMW8
196600.VV0949 WP_011149741.1.33883 WP_011149741.1.34622 WP_011149741.1.8379 WP_011149741.1.9921 gi|37679133|ref|NP_933742.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]