SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679162|ref|NP_933771.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679162|ref|NP_933771.1|
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily HPr-like 1.57e-26
Family HPr-like 0.0000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37679162|ref|NP_933771.1|
Sequence length 85
Comment phosphocarrier protein HPr [Vibrio vulnificus YJ016]
Sequence
MYEKQVEITAENGLHTRPAAQFVKEAKAFDADITVTSNGKSASAKSLFKLQTLGLVKGTV
VTISAEGPQAQQAVDHLVALMDQLH
Download sequence
Identical sequences A0A087IGS0 A0A0H0Y361 A0A0L7YZ16 A0A1L9L722 A0A1Q9HFP2 Q7MMT9 U2ZDJ6
gi|37679162|ref|NP_933771.1| gi|27363692|ref|NP_759220.1| WP_011078325.1.100126 WP_011078325.1.13374 WP_011078325.1.16238 WP_011078325.1.17874 WP_011078325.1.21633 WP_011078325.1.22486 WP_011078325.1.22778 WP_011078325.1.24453 WP_011078325.1.25536 WP_011078325.1.28111 WP_011078325.1.28215 WP_011078325.1.28571 WP_011078325.1.30871 WP_011078325.1.31968 WP_011078325.1.33883 WP_011078325.1.34622 WP_011078325.1.36074 WP_011078325.1.39407 WP_011078325.1.39524 WP_011078325.1.43691 WP_011078325.1.47396 WP_011078325.1.49981 WP_011078325.1.512 WP_011078325.1.53345 WP_011078325.1.53782 WP_011078325.1.54486 WP_011078325.1.54603 WP_011078325.1.54858 WP_011078325.1.55006 WP_011078325.1.553 WP_011078325.1.56046 WP_011078325.1.58875 WP_011078325.1.58885 WP_011078325.1.59022 WP_011078325.1.59048 WP_011078325.1.59451 WP_011078325.1.60167 WP_011078325.1.60868 WP_011078325.1.61535 WP_011078325.1.63462 WP_011078325.1.63825 WP_011078325.1.65015 WP_011078325.1.66219 WP_011078325.1.66581 WP_011078325.1.67868 WP_011078325.1.73066 WP_011078325.1.73173 WP_011078325.1.78369 WP_011078325.1.78668 WP_011078325.1.79678 WP_011078325.1.81060 WP_011078325.1.81460 WP_011078325.1.81555 WP_011078325.1.82587 WP_011078325.1.8292 WP_011078325.1.8379 WP_011078325.1.84562 WP_011078325.1.86005 WP_011078325.1.86748 WP_011078325.1.89979 WP_011078325.1.90288 WP_011078325.1.93668 WP_011078325.1.94371 WP_011078325.1.95941 WP_011078325.1.96968 WP_011078325.1.9921 WP_011078325.1.99976 gi|320157094|ref|YP_004189473.1| 196600.VV0978 216895.VV1_0210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]