SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679163|ref|NP_933772.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679163|ref|NP_933772.1|
Domain Number 1 Region: 3-313
Classification Level Classification E-value
Superfamily Tryptophan synthase beta subunit-like PLP-dependent enzymes 2.36e-96
Family Tryptophan synthase beta subunit-like PLP-dependent enzymes 0.000000000416
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37679163|ref|NP_933772.1|
Sequence length 322
Comment cysteine synthase A [Vibrio vulnificus YJ016]
Sequence
MSKIYEDNSLTIGNTPLVRLNKVSNGKVLAKIEARNPSFSVKCRIGANMIWEAEKEGKLK
PGVELVEPTSGNTGIALAFVAAARGYKLTLTMPESMSLERRKLLKALGANLELTEAAKGM
KGAIAKAEEIVASNPEKYLLLQQFNNPANPEIHEKTTGPEIWEATDGAIDVFVAGVGTGG
TITGTSRYIKGEKGKQILSVAVEPTESPVISQALAGEEIKPAPHKIQGIGAGFIPGNLDL
SLIDRVEKVTSEEAIEMARRLMEEEGILAGISSGAAVVAANRLAELPEFEGKTIVTVLPS
SGERYLSTALFAGIFTEKENQQ
Download sequence
Identical sequences A0A087JQU9 A0A0H0Y1F0 A0A1L9L733 Q7MMT8
196600.VV0979 gi|37679163|ref|NP_933772.1| gi|320157093|ref|YP_004189472.1| WP_011149755.1.100126 WP_011149755.1.13374 WP_011149755.1.16238 WP_011149755.1.21633 WP_011149755.1.22778 WP_011149755.1.24453 WP_011149755.1.25536 WP_011149755.1.28215 WP_011149755.1.28571 WP_011149755.1.30871 WP_011149755.1.31968 WP_011149755.1.33883 WP_011149755.1.34622 WP_011149755.1.39407 WP_011149755.1.43691 WP_011149755.1.47396 WP_011149755.1.49981 WP_011149755.1.512 WP_011149755.1.53782 WP_011149755.1.54486 WP_011149755.1.54603 WP_011149755.1.54858 WP_011149755.1.55006 WP_011149755.1.553 WP_011149755.1.58875 WP_011149755.1.58885 WP_011149755.1.59022 WP_011149755.1.59048 WP_011149755.1.59451 WP_011149755.1.60167 WP_011149755.1.60868 WP_011149755.1.61535 WP_011149755.1.63462 WP_011149755.1.63825 WP_011149755.1.65015 WP_011149755.1.66219 WP_011149755.1.66581 WP_011149755.1.67868 WP_011149755.1.73066 WP_011149755.1.78369 WP_011149755.1.78668 WP_011149755.1.79678 WP_011149755.1.81060 WP_011149755.1.81460 WP_011149755.1.81555 WP_011149755.1.8292 WP_011149755.1.8379 WP_011149755.1.84562 WP_011149755.1.86005 WP_011149755.1.86748 WP_011149755.1.89979 WP_011149755.1.90288 WP_011149755.1.93668 WP_011149755.1.94371 WP_011149755.1.95941 WP_011149755.1.96968 WP_011149755.1.9921 WP_011149755.1.99976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]