SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679166|ref|NP_933775.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679166|ref|NP_933775.1|
Domain Number 1 Region: 5-317
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 6.88e-122
Family Adenylation domain of NAD+-dependent DNA ligase 0.0000000881
Further Details:      
 
Domain Number 2 Region: 404-584
Classification Level Classification E-value
Superfamily RuvA domain 2-like 5.56e-61
Family NAD+-dependent DNA ligase, domain 3 0.0000678
Further Details:      
 
Domain Number 3 Region: 319-401
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-29
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00033
Further Details:      
 
Domain Number 4 Region: 596-668
Classification Level Classification E-value
Superfamily BRCT domain 4.86e-17
Family DNA ligase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37679166|ref|NP_933775.1|
Sequence length 669
Comment NAD-dependent DNA ligase LigA [Vibrio vulnificus YJ016]
Sequence
MSESKQQYLEELKQQLHYHAVRYYVEDNPEIPDAEYDRMMRELMAIEAEHPEWISVDSPS
QRVGGVALDSFRQVTHEIPMLSLDNAFSDEELESFLKRAQDRMPSAHIDAFCCEPKLDGL
AVSLLYENGVLVQAATRGDGTTGENITENVRTIASVPLKLQGEGWPSRIEVRGEVFMPKV
GFEKLNDIARKKGEKVFVNPRNAAAGSLRQLDSKITATRPLAFYAYSVGVVEGISLSSSH
YQRFLQLKQWGLPMCPETKLVNGLESVKAFYADILNRRDALPYEIDGVVIKIDDIVIQEK
LGFVARAPRWAIAYKFPAQEELTLLNDVEFQVGRTGAITPVAKLEPVFVGGVTVSNATLH
NADEIERLGVMVGDTVVIRRAGDVIPQIVSVVKERRKGDENPIVFPTSCPVCHSHVERIE
GEAVTRCSGGLVCQAQRKEALKHFVSRKALDVDGLGDKVIEQLVDKEMVETPADLFTLSA
GVLTVLERMGPKSAQNIVNALNVAKETTLARFLYSLGIREVGEATAANLARHFKTLEAIQ
TATHEQLIEVPDIGEVVARHITAFFAEEKNQRVVQALIEQGIVWPPVEELGSEIPQPLAG
KVVVLTGTLTQLSRGDAKAALERLGAKVTGSVSKKTDIVFAGEAAGSKLTKAQELGVEIQ
TEQDLLALL
Download sequence
Identical sequences Q7MMT5
196600.VV0982 WP_011149758.1.34622 gi|37679166|ref|NP_933775.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]