SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679178|ref|NP_933787.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679178|ref|NP_933787.1|
Domain Number 1 Region: 7-126
Classification Level Classification E-value
Superfamily CBS-domain pair 3.28e-25
Family CBS-domain pair 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37679178|ref|NP_933787.1|
Sequence length 135
Comment hypothetical protein VV0994 [Vibrio vulnificus YJ016]
Sequence
MNSHDKIRVRDVMANTFVVVDGLTTVHQGIRLAREHQVKALVVNKRHEDDEFGIVLMNDI
AKKVLAKNRSPNRTNIYEIMTKPALCVSPDMNVKYCARLFERFGISRAPVIENGEVIGMV
SYNNIVINAMARDDE
Download sequence
Identical sequences Q7MMS3
WP_011149769.1.34622 gi|37679178|ref|NP_933787.1| 196600.VV0994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]