SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679184|ref|NP_933793.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679184|ref|NP_933793.1|
Domain Number 1 Region: 240-495
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.87e-100
Family Hsp90 middle domain 0.000000844
Further Details:      
 
Domain Number 2 Region: 12-219
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.11e-64
Family Heat shock protein 90, HSP90, N-terminal domain 0.0000058
Further Details:      
 
Domain Number 3 Region: 522-634
Classification Level Classification E-value
Superfamily HSP90 C-terminal domain 9.94e-34
Family HSP90 C-terminal domain 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37679184|ref|NP_933793.1|
Sequence length 636
Comment heat shock protein 90 [Vibrio vulnificus YJ016]
Sequence
MKMNETVANNKETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADKLRFQALSN
PALYENDAELGVKLSFNEEHNTLTISDNGIGMSREEVISHLGTIAKSGTAEFFSKLSQEQ
SKDSQLIGQFGVGFYSAFIVADAVTVRTRAAGLNADQAVLWHSAGEGEYTVEDITKESRG
TDIILHMREDGKEFLNEWRLRDVIGKYSDHIGIPVSIQTRVRDEEGKETEEVKWEQINKA
QALWTRNKSDISDEEYQEFYKHVSHDFADPLLWSHNRVEGKNDYTSLLYIPSKAPWDMMN
RDHKSGLKLYVQRVFIMDDAEQFMPSYLRFVRGLIDSNDLPLNVSREILQDNKVTQSLRG
ACTKRVLTMLERLAKNDTEKYQTFWKEFGLVMKEGPAEDYANREKVAALLRFASTEVDSA
EQTVSLESYVERMKEGQDKIYYLTADSYAAAKNSPHLEQFKAKGLEVILMFDRIDEWLMN
YLTEFDGKQFQSITKAGLDLSQFEDEQEKEKQKETEQEFQSVVERTKSYLGDRVKEVRTT
FKLANTPAVVVTDDFEMGTQMAKLLAAAGQAVPEVKYIFEINPNHTLVKQMADEADEEAF
GRWVEVLLGQAMLAERGSMEDPSQFLTAINSLLTKG
Download sequence
Identical sequences gi|37679184|ref|NP_933793.1| 196600.VV1000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]