SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679197|ref|NP_933806.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679197|ref|NP_933806.1|
Domain Number 1 Region: 11-337
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.17e-103
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000000281
Further Details:      
 
Domain Number 2 Region: 340-548
Classification Level Classification E-value
Superfamily Ribosomal protein L25-like 1.57e-78
Family Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain 0.0000000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37679197|ref|NP_933806.1|
Sequence length 556
Comment glutaminyl-tRNA synthetase [Vibrio vulnificus YJ016]
Sequence
MSEADARPSNFIRQIIDKDLADGKHTSVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYQG
KCNLRFDDTNPEKEDIEYVESIKNDVSWLGFEWDDEICYSSNYFDKLYEYAVELINKGLA
YVDELSPEQIREYRGTLTAPGKPSPYRDRSAEENLALFEKMRDGGFEEGKACLRAKIDMA
SSFMVMRDPVLYRVRFASHHQTGDKWCIYPMYDFTHCISDALEGITHSICTLEFMDNRRL
YDWVLDNITIDCRPHQYEFSRLNLEYTVMSKRKLNQLVTEKLVNGWDDPRMPTISGLRRR
GFTPASIREFCKRIGVTKQENMIEFSSLESCIRDDLNENAPRAMAVLDPVKLVIENFPAG
EVENLTVANHPNKPEMGEREVPFSREIWIEREDFREEANKKYKRLVLGSEVRLRGAYVIK
AERVEKDDEGNITTIFCTYDSETLGVNPADGRKVRGVIHWVSADKGVPAEIRLYDRLFTV
PNPAAADDFASTINPESLTVMNGFVEPSLVEAEAEKGYQFERMGYFCADSKDSSKEHLVF
NRTVGLRDTWAKIEAK
Download sequence
Identical sequences A0A0H0Y2B8 A0A1L9L6X5 A0A1V8MZ74 Q7MMQ4
196600.VV1013 gi|326423664|ref|NP_759187.2| WP_011078293.1.16238 WP_011078293.1.17874 WP_011078293.1.21633 WP_011078293.1.22486 WP_011078293.1.22778 WP_011078293.1.33883 WP_011078293.1.34622 WP_011078293.1.39524 WP_011078293.1.53345 WP_011078293.1.54486 WP_011078293.1.55006 WP_011078293.1.66581 WP_011078293.1.73173 WP_011078293.1.79678 WP_011078293.1.81460 WP_011078293.1.82587 WP_011078293.1.90288 WP_011078293.1.93668 WP_011078293.1.94371 WP_011078293.1.9921 WP_011078293.1.99976 gi|37679197|ref|NP_933806.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]